KEGG   Desulfitobacterium hafniense Y51: DSY2007Help
Entry
DSY2007           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DSY2007
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY2007
   00052 Galactose metabolism
    DSY2007
   00500 Starch and sucrose metabolism
    DSY2007
   00520 Amino sugar and nucleotide sugar metabolism
    DSY2007
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DSY2007
   00524 Butirosin and neomycin biosynthesis
    DSY2007
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DSY2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2323164..2324252
Genome map
AA seq 362 aa AA seqDB search
MMDLPYAGIKKGQLYLAGDIGGTKTLLGLYSLEGTELVLVRERNFPSKDWQDLTALIQGF
LDEISLTPEGITGGCLSLAGPITQDKCFLTNLNRVIHCPDLRSSLPLRRPLLLVNDLEAM
GQGLMDLRGEDLICLNPSAESPSPSLASPPALSLARPSLNRALIAPGTGLGQAMILADGR
VCATEGAHGDYAPRTEQEIRLWRFLAQRYGHVSYERVLSGPGLADLYRFLYWEALSPSLP
SPASDSIPTPDSSLTPAEITKKALDGICPLCTETLELFVKILGAEAGNLALRTLAYGGIY
LGGGIPPKILPKLQEDGFMEAFLAKGRLRELLSQIPIYVILNERTPLLGAARLAAAAGCP
PA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgatggatttgccttatgcgggcattaaaaaaggccaactatacttggctggagacatt
ggcggaaccaaaactctcctaggactttattccctggaaggtactgagcttgtcttagtc
agggaaaggaatttccccagtaaagactggcaagacttaacagcccttatacaaggattt
ttagatgaaatatccctaacgcctgaaggaataaccggaggctgcctcagcctggccggg
cccatcactcaagataagtgtttcctcaccaacttgaatcgggttattcattgtcctgac
ttgcgctcctccctgccattgcgaaggcctctgcttttggttaacgaccttgaggctatg
gggcagggcctcatggatttaaggggggaagatttaatttgtctcaacccttccgcagag
agtccttccccttcccttgcctcgcctcctgccctttccctcgccaggccctcacttaac
cgggcactgatcgcccccggtacaggcttgggtcaggccatgatcctggctgacggacgg
gtttgcgccacggaaggcgcccatggggactatgccccccgcaccgagcaggaaatacgg
ttgtggcgctttctggctcaacgatacggtcatgtcagctatgagagagtcctctccggt
cccgggctggcagatctctatcgttttctgtactgggaggctctttccccctctctccct
agcccggcctctgactctatccctacccctgattctagccttactcctgccgagatcaca
aaaaaagccctcgacggaatctgtccactctgtacagaaacattggagctctttgtgaaa
attctgggcgcggaagcaggcaatctcgctttaaggactttggcctatggaggaatctat
ctgggcgggggcatcccccctaaaatcctgcccaagcttcaggaagatggcttcatggag
gcctttctcgctaaaggccgtttgagagagcttttatcccagatccctatctatgtgatc
cttaatgaaaggactcccttgctgggggccgcccgtttggcggcggcagccgggtgtcct
cctgcatga

DBGET integrated database retrieval system