KEGG   Desulfitobacterium hafniense Y51: DSY2035Help
Entry
DSY2035           CDS       T00333                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DSY2035
Enzymes [BR:dsy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DSY2035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2360775..2364335)
Genome map
AA seq 1186 aa AA seqDB search
MSVVLAYHNSHDPFFRSPFGAVPCGGLLRLRLLMQPEDSSGAGSPVQECFLRLWVQDREE
RLPMLRVEEPILWEINREGTVTGEEAITGEGVLTGEGVVYEVEYPLPHEPGIIWYYFIFR
AGGETCFYGNNQEELGGVGELRSSEPPGYQITVYRPMALPGWYTQGIMYQIYVDRFFNGD
EQGKVLNPRPRSLIHGDWYDTPFYIKNEKGEVLRWDFFGGNLAGVIKKLPYLKELGVSIL
YLNPIFDSSSNHKYDTADYLTLDPMYGDEEIFAQLIKEAQSLGMAIILDGVFSHTGDDSI
YFNRYGRYPGLGAYQSPDSPYYSWYQWQGDGEEKEYSCWWGVATLPEVKELEPSYREFII
HSPQGVLRSWMKRGIKGWRLDVADELPDEFIQEFRQGMKAMDPDAVLIGEVWEDPTHKFS
YGKLRQYFWGGELDATMNYPWRKILLQYFLGEIDAGQLHKKIMNLYENYPRENFFGQMNL
IGSHDRARILTLLSEAPPPEQLSAAEQEHYRLPAPARELAVRRLKLLTLLQMSFPGVPCL
YYGDEAGCEGYPDPYNRGTYPWGREDQEILQWFKRVLRYRREYEVLRQGEFSSWSEGKEI
YALQRKGEKEEIIVLVNRSAEESTEMTLKLEQNVGQVIDIFAGEVLHGLSLILPPLSAKA
LFCQKHGPNHYFKQELMTRACGILMHISSLPSPWGIGDLGEEAYAFVDFLAEGGQSLWQV
LPLNPLGLGDSPYQSESALAGNFLLISLDLLIEAGLLTEEEARREWADYGQEVKKAEGSE
GPEGLGSEGFAWVERYKEKLLRKAYERFKEKLPRYPLDLSSPEGGSQPGTKGYLDPQGYD
RFIEENQDWLQDYALYKCLKLKFSGKGWHQWEESYRLRKPEALEAVTEDYAEEINYIFFV
QYTFADQWQRLKDYAQEKGVKIIGDLPIYVAYDSCDTWANRECFALDENNAPTGTAGVPP
DYFNPEGQNWGNPLYDWEALRSADYAWWKLRFRQGLERFDALRLDHFRGFEGYWEVPPQA
GSAKEGRWLKGPGKEFFESLVRELGPLPVIAEDLGCITPEVNTLRAILGFPGMRVTQFSP
LQQEGNYVDYSGTHDNDTLLGWYRSQGYSDKDSLAQVERTIEELYQGNGIWVILPLQDIL
KLDSQARMNTPGTIKGNWQWRVERGTLTQDVCARLRGLAEKYERLS
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggtattggcttatcataattctcacgatcccttcttccgcagcccctttggg
gctgttccatgcggcggtctgctgcgcttaagactgcttatgcagccggaggattcttct
ggtgcgggcagtccggttcaggaatgctttttgcgcttatgggtgcaggaccgggaggag
cggttgcccatgctcagggtggaagagccgatcctgtgggagataaatagggaaggaact
gttacaggggaagaggctattacaggggaaggggtccttacgggagaaggagtcgtttat
gaggtggaatatcctcttccccatgaaccgggaatcatctggtattactttattttcagg
gcagggggagaaacctgtttctatggcaataatcaggaagaactgggaggcgtgggtgag
cttcgatcctccgagcctcccggttatcaaatcaccgtttaccggcccatggccttgcca
ggctggtacacccagggcatcatgtatcagatctatgtggatcgcttctttaacggggat
gaacagggaaaagtcctcaatccccgcccccgctccctgatccatggggactggtatgat
acccccttctatattaaaaatgaaaagggcgaagtcctacgctgggattttttcggcggc
aaccttgccggtgtgatcaaaaagcttccttaccttaaggaattaggggtgagtatcctc
tatttgaaccccatcttcgattcctccagcaaccataagtatgacacggcggattatctt
acccttgaccctatgtatggggatgaggagatctttgcccaattgatcaaggaagcccaa
agcttaggaatggcgattattctggatggggtgttcagtcataccggtgatgacagtatt
tattttaaccgctacgggagataccctggtctgggggcctatcaatccccggattccccc
tattactcctggtatcaatggcagggagatggggaggaaaaggagtattcctgctggtgg
ggagtggccacccttcctgaagtcaaggagctggagccctcttatcgtgaatttatcatt
cactcaccccagggagttctccggtcctggatgaagcggggcattaaaggctggcgtctg
gacgtggccgatgagcttcccgatgaattcattcaggagttccggcaaggaatgaaagct
atggaccctgacgcagtgcttattggtgaagtctgggaggaccccactcataaattcagc
tatggcaagctcaggcagtacttctggggcggggaactggatgccaccatgaattatcct
tggcggaagatcttgctccaatactttctgggggagatcgatgccggtcagctccataaa
aagattatgaatctctatgaaaactacccgcgggaaaacttttttgggcagatgaatttg
atcggcagccatgatcgcgcccggattctcaccttgcttagtgaagctccgccgccggag
cagctctcggccgcggaacaggagcattatcgtttgcctgcccctgcccgggaactggct
gtccggcggttaaagctgctgactttgctccagatgagcttccccggtgttccctgcctg
tattacggcgatgaagcgggctgtgagggatatcccgatccctataaccgggggacctac
ccttggggaagggaagatcaggagatcctccaatggtttaagcgggtgctccgttatcgc
cgggaatatgaggtactgcggcaaggtgaattttcttcctggtccgaggggaaagagatt
tatgccttgcaaaggaagggcgaaaaagaagagattattgtcctggtcaatcgcagtgct
gaggagtccacggaaatgaccttgaagctggagcagaacgtggggcaggttattgatatc
tttgcgggggaagtgctgcacggtctttcgcttatcctaccccccttatccgcaaaggcc
cttttctgtcagaagcatggtccaaaccactattttaaacaggagcttatgacccgtgcc
tgcggcatccttatgcatatctcctctttgccgtctccctggggcattggcgatctgggg
gaagaggcctatgcttttgtggatttcctggctgaaggagggcaaagcctctggcaggtg
ctgcctttgaaccctctagggctgggagattccccttaccaaagtgagtccgccttagcc
ggtaattttttgctgatcagtcttgatttgcttattgaggccgggctgctgaccgaagag
gaggcccgcagggaatgggccgactatggtcaagaggttaaaaaggctgagggaagcgaa
ggacccgaaggcctcgggagcgagggctttgcctgggtggaacgctataaggagaagctg
ctgcgcaaggcttatgaacgtttcaaggagaaattgcccaggtaccctttggatttaagc
agcccggagggaggcagccagcctggaactaaggggtacttggaccctcagggttatgac
cggtttatagaagagaatcaggactggctgcaagactacgctctctataagtgtttaaag
cttaagttctccggcaaggggtggcaccaatgggaagaaagctatcgcttgcggaagcct
gaggccctggaggctgtgactgaagattatgccgaggagataaactatattttctttgtt
caatatactttcgctgatcagtggcaaaggctgaaggactatgctcaggaaaaaggggta
aaaataatcggcgatctgcccatttatgtggcctatgacagctgcgacacctgggctaac
cgggagtgctttgctctggatgaaaataatgctcccacaggaaccgctggggtgcccccc
gactatttcaaccctgaagggcagaactggggaaatcccttatacgattgggaggctctc
cggtccgccgattatgcctggtggaagctgcgtttccggcaagggctggagcgctttgat
gccttaagactggatcatttccgtggctttgagggctattgggaagttccccctcaggcc
gggagcgccaaggaaggccgctggctgaaagggccggggaaagaatttttcgaaagcctg
gtccgtgaattggggcctctgcccgtcatcgctgaggatttagggtgcattacccctgaa
gtcaataccctgagagctattttaggatttccggggatgagggtgacgcagttttcaccc
ttgcagcaagaagggaattatgttgattattccggaacccatgataacgataccctgttg
ggctggtatcgctcccaaggctatagcgataaggattccctggcgcaagtggaaaggact
atcgaggagctttatcaggggaatggtatctgggtcattcttccccttcaggacattctt
aaactggattcccaggcgaggatgaatactcccggcacaattaaagggaattggcagtgg
cgtgtagaaagaggaaccttaactcaggatgtctgtgctcgattaaggggtttggcggaa
aaatatgagcggttatcctga

DBGET integrated database retrieval system