KEGG   Desulfitobacterium hafniense Y51: DSY2467Help
Entry
DSY2467           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DSY2467
Enzymes [BR:dsy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DSY2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2822452..2823057)
Genome map
AA seq 201 aa AA seqDB search
MIGMLRGKVWEIQADKLILDVQGVGYQLSIPYGLLGKAHPGHELILYTHVILREDELALY
GFSSAAEKELFLLMLSVSGIGPKAALSILSTLGIGQTESAIASENITLLTKVPGIGKKTA
QRLILELKEKFKGRAIALEGIEGAGSLPQAAFHSEAMETLLALGFSQEEAKKALQALPDS
AQALSTEEQVRLALRSLAATK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgataggaatgctcagaggaaaggtatgggagattcaagccgataaattgattctggat
gttcagggagtaggctatcaattatccatcccgtatggattattaggcaaagcacatcct
ggtcacgagctgattctgtatacccatgtgattttgcgggaggatgagctggctctgtac
ggtttttcttcagcagcggagaaagagctcttcttgctgatgctttccgtatcgggcatt
ggacccaaagcagccttatcgatcctatcgactttaggcattggccagacagaaagtgcc
attgccagtgaaaatattacccttttgaccaaggtgcccggtatcggcaaaaaaacggca
cagcgcttgattttagagttaaaagagaaattcaaaggccgggccatagcgttggagggg
atagagggagcaggaagcttgccccaggctgcttttcactcggaagctatggaaaccctg
ctggctttgggattcagccaagaggaagctaagaaagcgctccaagctcttcccgattca
gcccaagcattgagtacggaggagcaggtacgattggcgctgcgctctcttgccgcgaca
aagtaa

DBGET integrated database retrieval system