KEGG   Desulfitobacterium hafniense Y51: DSY2583Help
Entry
DSY2583           CDS       T00333                                 

Gene name
nuoI
Definition
NADH dehydrogenase I subunit I (EC:1.6.5.3)
Orthology
K00338  
NADH-quinone oxidoreductase subunit I [EC:1.6.5.3]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dsy00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2953271..2953678)
Genome map
AA seq 135 aa AA seqDB search
MLGKGLLTGMGIVLKKMLGPNITEFYPEVMPNLPKTVRSSMGLEPDKCISCTLCALACPN
KVITLTSEKDENNKKVLKTYHMDVGRCLFCGLCTEACPTNALTVTQEFENSVFYPEDLYW
DMIERSKRNGKEGNE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
gtgttaggtaaaggattattaacgggaatgggcatcgtgctcaagaagatgctcggacca
aatatcacagagttctatcctgaggttatgccgaatcttcccaagaccgttcgcagctcc
atgggactggagccggataagtgcatctcctgcacattatgcgctttggcctgtccgaac
aaggtcattaccttaaccagtgaaaaggatgagaacaataaaaaagttctcaagacctat
cacatggatgtagggcgttgcttgttctgcggcctctgcacggaagcatgtcctacgaat
gcgctgaccgtgacccaggagtttgagaactccgtcttctatcctgaagatttatattgg
gatatgattgagcgttcgaagcgtaatgggaaggagggcaacgaatga

DBGET integrated database retrieval system