KEGG   Desulfitobacterium hafniense Y51: DSY2755Help
Entry
DSY2755           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DSY2755
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY2755
  Lipid metabolism
   00071 Fatty acid degradation
    DSY2755
  Amino acid metabolism
   00350 Tyrosine metabolism
    DSY2755
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DSY2755
   00626 Naphthalene degradation
    DSY2755
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DSY2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3127785..3128990)
Genome map
AA seq 401 aa AA seqDB search
MKNINKQQEEIIMFNMYVPTRFVFGSGRLRELHQQKMPGKKALITISNGKSVRENGALDR
TQEQLRLAGVAMVVFDKIGANPTKTAVMEGAKSARDHGCDFIVALGGGSVMDAAKAIAMM
ATNDGDLWDYVGGKTGKGQALRHEPLPLVCITTTAGTGSEADQWGVVTNEETNEKIGVGG
YDASFPVVSIIDPELMVSVPPKFTAYQGFDALFHATEGYISKFASPMSDMYALTAIENVG
NYLVRACRDGRDMEAREGMAFANTLSGVVMTVSVTTAEHSLEHAMSAYHPELPHGAGLIM
ISRAFYEFFIEKHACDQRFVRMAQALGMKDAARPEDFITMLVKLQENCGVADLKMSDYGM
TPDEFDKLAANARETMGGLFAANPYAMTHEDCVEVYRKSYR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatatcaacaagcaacaggaggaaataatcatgtttaatatgtatgtacctacc
cgttttgtctttggcagcggccgcctgagggagctgcatcagcaaaaaatgcccggtaaa
aaagcgctgattactatctccaacggcaagtctgtccgggaaaacggcgccctggaccgc
acacaggagcagcttcgtcttgccggggtggcaatggttgtgttcgacaaaataggggcc
aaccccaccaagaccgccgtaatggagggggcaaaatctgcccgtgaccacggctgtgat
tttatcgtggctttaggtggcggcagtgtcatggatgcggccaaagccatagccatgatg
gccaccaacgacggcgacctgtgggattatgtggggggcaaaacaggcaaggggcaggcc
ctccgccatgagcccctgcccctcgtctgcattaccaccacggccggaaccggcagcgag
gcggaccaatggggcgttgtgactaacgaggaaaccaatgaaaagatcggtgtcggcggc
tatgatgccagtttcccggtagtgtcgatcattgaccctgagctcatggtgtccgtgcct
cccaagtttaccgcctaccaaggatttgatgccctgttccacgccaccgagggctatatt
tccaaatttgccagccctatgagcgatatgtatgccctgacggcgattgagaatgtgggg
aactatctggtccgtgcctgccgggatggcagggatatggaagcccgggaagggatggcc
tttgccaacaccctctccggtgtggtgatgactgtcagtgtgacaacggcggaacactcc
ttggagcacgccatgtccgcctatcaccctgagcttcctcacggtgcgggactgattatg
atttcccgggccttttacgaattctttatcgaaaagcacgcttgtgatcagcgctttgtc
cgtatggcccaggctttgggcatgaaggatgctgccaggccggaagactttatcaccatg
ctggttaagcttcaggaaaactgcggtgtggccgacctgaaaatgagcgattacggtatg
actcccgatgagttcgacaagctggcagccaatgcccgtgagaccatgggcggtctgttc
gcagcgaatccctatgcaatgactcatgaggactgcgtggaagtttacagaaaatcatat
cgctga

DBGET integrated database retrieval system