KEGG   Desulfitobacterium hafniense Y51: DSY2755Help
Entry
DSY2755           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00010  Glycolysis / Gluconeogenesis
dsy00071  Fatty acid degradation
dsy00350  Tyrosine metabolism
dsy00625  Chloroalkane and chloroalkene degradation
dsy00626  Naphthalene degradation
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01120  Microbial metabolism in diverse environments
dsy01130  Biosynthesis of antibiotics
dsy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY2755
  Lipid metabolism
   00071 Fatty acid degradation
    DSY2755
  Amino acid metabolism
   00350 Tyrosine metabolism
    DSY2755
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DSY2755
   00626 Naphthalene degradation
    DSY2755
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DSY2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: BAE84544
UniProt: Q24TU8
Position
complement(3127785..3128990)
Genome map
AA seq 401 aa AA seqDB search
MKNINKQQEEIIMFNMYVPTRFVFGSGRLRELHQQKMPGKKALITISNGKSVRENGALDR
TQEQLRLAGVAMVVFDKIGANPTKTAVMEGAKSARDHGCDFIVALGGGSVMDAAKAIAMM
ATNDGDLWDYVGGKTGKGQALRHEPLPLVCITTTAGTGSEADQWGVVTNEETNEKIGVGG
YDASFPVVSIIDPELMVSVPPKFTAYQGFDALFHATEGYISKFASPMSDMYALTAIENVG
NYLVRACRDGRDMEAREGMAFANTLSGVVMTVSVTTAEHSLEHAMSAYHPELPHGAGLIM
ISRAFYEFFIEKHACDQRFVRMAQALGMKDAARPEDFITMLVKLQENCGVADLKMSDYGM
TPDEFDKLAANARETMGGLFAANPYAMTHEDCVEVYRKSYR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatatcaacaagcaacaggaggaaataatcatgtttaatatgtatgtacctacc
cgttttgtctttggcagcggccgcctgagggagctgcatcagcaaaaaatgcccggtaaa
aaagcgctgattactatctccaacggcaagtctgtccgggaaaacggcgccctggaccgc
acacaggagcagcttcgtcttgccggggtggcaatggttgtgttcgacaaaataggggcc
aaccccaccaagaccgccgtaatggagggggcaaaatctgcccgtgaccacggctgtgat
tttatcgtggctttaggtggcggcagtgtcatggatgcggccaaagccatagccatgatg
gccaccaacgacggcgacctgtgggattatgtggggggcaaaacaggcaaggggcaggcc
ctccgccatgagcccctgcccctcgtctgcattaccaccacggccggaaccggcagcgag
gcggaccaatggggcgttgtgactaacgaggaaaccaatgaaaagatcggtgtcggcggc
tatgatgccagtttcccggtagtgtcgatcattgaccctgagctcatggtgtccgtgcct
cccaagtttaccgcctaccaaggatttgatgccctgttccacgccaccgagggctatatt
tccaaatttgccagccctatgagcgatatgtatgccctgacggcgattgagaatgtgggg
aactatctggtccgtgcctgccgggatggcagggatatggaagcccgggaagggatggcc
tttgccaacaccctctccggtgtggtgatgactgtcagtgtgacaacggcggaacactcc
ttggagcacgccatgtccgcctatcaccctgagcttcctcacggtgcgggactgattatg
atttcccgggccttttacgaattctttatcgaaaagcacgcttgtgatcagcgctttgtc
cgtatggcccaggctttgggcatgaaggatgctgccaggccggaagactttatcaccatg
ctggttaagcttcaggaaaactgcggtgtggccgacctgaaaatgagcgattacggtatg
actcccgatgagttcgacaagctggcagccaatgcccgtgagaccatgggcggtctgttc
gcagcgaatccctatgcaatgactcatgaggactgcgtggaagtttacagaaaatcatat
cgctga

DBGET integrated database retrieval system