KEGG   Desulfitobacterium hafniense Y51: DSY2992Help
Entry
DSY2992           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DSY2992
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DSY2992
Enzymes [BR:dsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DSY2992
Two-component system [BR:dsy02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DSY2992
Bacterial motility proteins [BR:dsy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DSY2992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3391277..3392455)
Genome map
AA seq 392 aa AA seqDB search
MNQPKSPITVLIVDDSPFMRLTLQKILSQDPEIKVLDTARDGKEGIEKLQALRPQVVTMD
IEMPQIDGLQALGEIMRWQPTPIIILSALTTEGAQASVKALEAGAFDVVAKPSGGPGADI
QALARDLIDKVKAAAQVNLGRLGKKGAVSRISSASGSRPPWTAGAASENTNRLSSPGSTS
STLGSAKGRSLDSGEALPKYPVEIVAIGTSTGGPSALQAVLTQLPGNLPVPVLVAQHMPP
GFTAPLAQRLNGMSPLTIREGVHGEALKAGTIYFAPAGKQMQVQSRGSQLILHIGDESPI
TTLYHPSVDVMFMSLAKEVGKGTLGVVMTGMGNDGLRGMREIKERGGYAIAEAEETCVVY
GMPRAIVDAGLANRVAPLGEIARHIVECVQRR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcctaaatccccaatcaccgttttgattgtggatgattcaccttttatgcgg
ttaactttgcaaaaaatattaagtcaggatccggagattaaggtactggatacggcccgg
gatggcaaggaaggcattgaaaagcttcaagccctccgtccccaagtggtgactatggat
attgagatgccccagattgacgggctccaagccctgggtgaaatcatgcgctggcagcct
actcccatcattatccttagtgctttgaccacagagggggcacaggccagtgttaaagcc
ttggaagcaggcgctttcgatgtggttgccaaaccttctgggggaccgggtgcggatatt
caggctttagcccgggatttaatcgataaagtgaaagcagctgcacaggtgaatctagga
cgattgggcaaaaagggggccgtaagccgaatttcgtctgcttcaggaagccggcccccc
tggactgccggggctgccagtgaaaacacgaatcgattatcctctccgggcagtacgagc
tcaaccttaggaagtgcgaaaggacgttctttggatagtggagaagccttgcccaagtat
cctgtggagattgtagcgattggtacttctaccgggggaccgtcggctttgcaagcggtc
ttaacccagctgccgggaaatctccctgtgccggtattggtggcgcagcatatgccgccg
gggtttacggcgcccttggctcagcgccttaatgggatgtcccccctcactatccgggaa
ggagttcatggcgaggctctgaaagcaggcaccatttattttgcgcctgccggtaaacaa
atgcaggtgcagagccgtggctcccagctcattctgcatattggcgatgaatccccgatt
accaccctctatcatccgtcggtggatgttatgttcatgtctttggcgaaggaagtcggt
aaaggcactttaggtgtggtgatgaccggaatgggcaatgacggacttaggggaatgcgg
gagatcaaggaacggggaggctatgctatcgcagaggctgaagagacctgtgtggtttat
ggtatgccccgggccattgtggatgcggggttagccaatcgggtagctcctttgggagaa
atcgcccggcatattgttgaatgtgtgcaaaggaggtag

DBGET integrated database retrieval system