KEGG   Desulfitobacterium hafniense Y51: DSY3201Help
Entry
DSY3201           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DSY3201
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DSY3201
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DSY3201
Enzymes [BR:dsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DSY3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3624935..3625801
Genome map
AA seq 288 aa AA seqDB search
MSDRLETALAKARLKTPENPLGMGLITYLMAGDPDTDTTLRRLSGLVKAGVDILELGVPF
SDPIADGPVIQAAGLRALQQGMNLQKVLNLAARFRKENQTTPLLLMSYLNPLIHYGYDRF
LSDACTAGVDGLILPDLPWRESTPFRQRAYELLQDHLAFIPMIAQTSRPAHIHGLAQEQK
GFIYVLSRNGITGGDAEIPPQTLQFIDSLQTALSAPCYVGFGIQSPTQVHTLSQACQGVI
VGSALVQKFAQLDACALPAHELVHREQDIYAWIGSLRKTSVREELACE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatcgtttagaaacagctctggccaaagctcgcctcaaaacacccgagaatcct
ttgggcatgggattgatcacttatcttatggccggggaccctgatactgacaccaccctg
cgccgtttaagcggccttgttaaggccggagtcgatatactcgaactgggcgttcctttc
agcgaccctatcgccgatggccctgtcatccaagccgccggcttacgagccctgcagcag
gggatgaatctccaaaaggtcttaaacctcgccgcccggttccgcaaggaaaatcagacc
actcccctgcttttaatgagctatctcaatcccctcattcattacggctatgatcggttt
ctcagcgatgcctgcacagccggagtcgatggtttgatactgcctgatctgccatggcgg
gaaagcacacctttccggcaaagagcttatgaacttctccaggaccacctggcctttatc
cccatgattgcccagaccagccggcccgctcacattcatggccttgcccaggagcagaag
ggctttatctacgtcctctcccgcaacgggatcaccggaggagatgcggaaattccgcca
caaaccctgcaattcattgactccctccagaccgctctttccgccccctgctatgtggga
tttggcatccaatccccaacccaggtgcatacattgagccaagcctgccaaggggtcatt
gtgggcagtgctctggttcaaaagtttgcccagctcgatgcctgtgcgctccctgctcac
gagctagtgcaccgcgaacaggacatctatgcctggattggttccttaagaaaaacatcg
gtcagggaggaacttgcatgcgagtga

DBGET integrated database retrieval system