KEGG   Desulfitobacterium hafniense Y51: DSY3201Help
Entry
DSY3201           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DSY3201
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DSY3201
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DSY3201
Enzymes [BR:dsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DSY3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3624935..3625801
Genome map
AA seq 288 aa AA seqDB search
MSDRLETALAKARLKTPENPLGMGLITYLMAGDPDTDTTLRRLSGLVKAGVDILELGVPF
SDPIADGPVIQAAGLRALQQGMNLQKVLNLAARFRKENQTTPLLLMSYLNPLIHYGYDRF
LSDACTAGVDGLILPDLPWRESTPFRQRAYELLQDHLAFIPMIAQTSRPAHIHGLAQEQK
GFIYVLSRNGITGGDAEIPPQTLQFIDSLQTALSAPCYVGFGIQSPTQVHTLSQACQGVI
VGSALVQKFAQLDACALPAHELVHREQDIYAWIGSLRKTSVREELACE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatcgtttagaaacagctctggccaaagctcgcctcaaaacacccgagaatcct
ttgggcatgggattgatcacttatcttatggccggggaccctgatactgacaccaccctg
cgccgtttaagcggccttgttaaggccggagtcgatatactcgaactgggcgttcctttc
agcgaccctatcgccgatggccctgtcatccaagccgccggcttacgagccctgcagcag
gggatgaatctccaaaaggtcttaaacctcgccgcccggttccgcaaggaaaatcagacc
actcccctgcttttaatgagctatctcaatcccctcattcattacggctatgatcggttt
ctcagcgatgcctgcacagccggagtcgatggtttgatactgcctgatctgccatggcgg
gaaagcacacctttccggcaaagagcttatgaacttctccaggaccacctggcctttatc
cccatgattgcccagaccagccggcccgctcacattcatggccttgcccaggagcagaag
ggctttatctacgtcctctcccgcaacgggatcaccggaggagatgcggaaattccgcca
caaaccctgcaattcattgactccctccagaccgctctttccgccccctgctatgtggga
tttggcatccaatccccaacccaggtgcatacattgagccaagcctgccaaggggtcatt
gtgggcagtgctctggttcaaaagtttgcccagctcgatgcctgtgcgctccctgctcac
gagctagtgcaccgcgaacaggacatctatgcctggattggttccttaagaaaaacatcg
gtcagggaggaacttgcatgcgagtga

DBGET integrated database retrieval system