KEGG   Desulfitobacterium hafniense Y51: DSY3289Help
Entry
DSY3289           CDS       T00333                                 

Definition
deoxyguanosinetriphosphate triphosphohydrolase-like protein
Orthology
K01129  
dGTPase [EC:3.1.5.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dsy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3717166..3718602)
Genome map
AA seq 478 aa AA seqDB search
MEWDTLLSTQKLIDEDPEPREFDQYPINAFEKDYSKIVSSAVFRRLQDKTQVFPLDKSDF
IRTRLTHSIEVSTIARQMGIMISKNKTKYRPKDIDNSRAENIASVLLCAGLLHDLGNPPF
GHFGETTIGEWFQEHLGTIKYKDVLLKDWLNKQMINDLENFEGNAQALRILSKAQHNSEI
NLSAAIISTLVKYPTSSISFKRDHPDIKKHKLGYYFAENAIFNKISEVVGTKNEKGEIYR
HPLTHMLEAADDIAYATADLEDAFKKRLFTLDEFITYFESCLDREKAVKNTNPDYYSLLL
INTLKDKRGKQHNLSQDSKVFKEWIIYIRRWLMYTAVYRFSRSYSDIMAGDYTNDLFHDT
NHSKTIRILKDSMNRFVFNSSGILKLELASQTILSFLLDKFVHAALYYDYAEGEFRPTKA
DKKYMNIFSDNYKQDYNSAKTSDEVMDLYLRLLMVTDYISGMTDSYARMLYRELSGIE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggatacattgctatcgactcaaaaattaatagatgaggatccagagcctcgg
gaatttgatcaatatccgatcaatgcatttgaaaaagattatagtaaaattgtttcaagt
gctgtattccgtaggctacaggataagactcaagtgtttcccttagataagagcgatttc
ataaggacgcgcctgactcattcaatagaagtatcaactattgcccgacagatgggaatt
atgatttcaaaaaacaagacaaaataccggcccaaagatattgataattcaagagcggag
aatatagcatctgtgctgttatgtgccggacttcttcatgatttgggcaatcctccattt
ggtcattttggtgaaactacaataggagagtggtttcaagagcatttaggaactataaaa
tacaaggacgttttattgaaagattggctgaataaacaaatgatcaatgatctggagaat
tttgaaggcaatgcgcaggcattgcgaattctatccaaagcccagcataattcagaaatt
aatttgtcagcggctatcatcagtactttggttaaatatcctacttcttctatatcattc
aaaagagaccatcctgatataaagaaacacaaactgggatactattttgcagagaacgct
atatttaacaaaatttcagaagtcgtgggaaccaaaaatgaaaagggtgaaatatatcgg
catcccttaacgcatatgctagaagctgcagatgatattgcctatgctaccgcagactta
gaagatgcctttaaaaagagattatttacccttgatgaatttattacatattttgaatct
tgtttggatcgtgaaaaggcagttaaaaatactaatccggactattattccctactttta
atcaatacgttaaaggataaacgaggaaaacagcataatcttagtcaagatagtaaagta
ttcaaagaatggattatatatatacggcgatggcttatgtatactgcagtgtatcgtttt
tcacgaagctattcagatatcatggcgggagattatacgaatgacttatttcacgataca
aatcattctaaaacgataagaattctcaaagattctatgaatagatttgtttttaattct
tcgggaatattaaaattggaacttgcttcacagactattctttctttcctgctcgataaa
tttgttcacgcagctttatactacgattatgctgaaggagaatttagaccaacaaaagct
gataagaagtatatgaatattttctcagataattacaagcaggactataattcggcaaag
acttctgatgaagtgatggacttatacctgcgtttgctgatggtgaccgactatatcagc
ggtatgacagattcctatgcacgtatgttatatcgtgaattgagtgggatcgagtag

DBGET integrated database retrieval system