KEGG   Desulfitobacterium hafniense Y51: DSY3353Help
Entry
DSY3353           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00040  Pentose and glucuronate interconversions
dsy00052  Galactose metabolism
dsy00500  Starch and sucrose metabolism
dsy00520  Amino sugar and nucleotide sugar metabolism
dsy01100  Metabolic pathways
dsy01130  Biosynthesis of antibiotics
Module
dsy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DSY3353
   00052 Galactose metabolism
    DSY3353
   00500 Starch and sucrose metabolism
    DSY3353
   00520 Amino sugar and nucleotide sugar metabolism
    DSY3353
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DSY3353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAE85142
UniProt: Q24S50
Position
complement(3798050..3798934)
Genome map
AA seq 294 aa AA seqDB search
MSTRRIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVHSGIEDIIIVTG
RNKRAIEDHFDRSIELETFLQKSEKEELLDMVQDIARMVDIYYVRQKEALGLGHAIYCAR
KFIGNEPFAVLLGDDIIHSEVPCLRQMMHVYERHGASIVGVQQVPLEDTSKYGIVDAVPL
DDSLYRALDLVEKPQPEDAPEARLAIMGRYILNPEIFGILESIPPGKGGEIQLTDGLKEL
ARFQEILAYEFDGQRYDVGDKLGFVQATIEYALRREDLAEPLMRYLKQRIESDE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacgcgacggattagaaaggccattattccggcagcaggcttgggaacccggttt
ttacccgctaccaaagcccagcccaaagagatgcttcccatcgtggataaaccgactatt
caatacattgtcgaggaagctgttcactccggaatcgaagatattatcattgtcaccggc
cgcaataagcgggccattgaggaccattttgatcgctccatagaattggagacctttctt
cagaaaagtgagaaggaagaactcctggacatggttcaggatatagcccggatggtggat
atttattatgtgcgccagaaagaagctttggggctgggacacgctatttattgtgccaga
aaattcattggcaacgagccctttgccgtcctgttaggcgatgatattatccattccgaa
gtaccctgcctcaggcagatgatgcatgtctacgaacgccatggtgccagtatcgttggc
gtccaacaggtacccctggaagatacctcaaagtatggaattgttgacgcggtacctctc
gatgattccttataccgggctctggacctggtggaaaagccacagcctgaggatgctcct
gaggcccgtttggccatcatgggccgctatattcttaatcccgagatttttggcattctg
gagagtatcccccccggcaaaggaggagagatccagcttacggacggtttaaaagaactg
gccaggttccaggagattcttgcttatgagttcgacggacagcgttatgatgtgggggac
aagctgggttttgttcaagccaccattgaatatgccctgcgccgggaagacctcgccgaa
cctctcatgcgctacctcaaacaacggattgaatcggatgaatag

DBGET integrated database retrieval system