KEGG   Desulfitobacterium hafniense Y51: DSY3869Help
Entry
DSY3869           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DSY3869
Enzymes [BR:dsy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     DSY3869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4421971..4423896)
Genome map
AA seq 641 aa AA seqDB search
MKTYNCFPFAAVCGQEKVKKALILAAINPRIGGVLISGEKGTAKSTLVRGLAQIMEDTDL
INLPLNITEDRLVGSIDMGKAIQYGQKELEEGLLKKAHGQFLYVDEVNLLSPHIAGILLE
VAATGVNIIEREGISHSHPARFVLVGSMNPEEGILSPQFLDRFGLYMEAKGEKEKAVRTE
IMQRRLAYEQDPEGFCTQWQEAGQVLARRIKSSKSMLKEVQVPEEGYKLAAELAKAGRCA
GHRAEIILVETARALAALAQRTELTAGDIREAATYVLPHRLRESLAIEEVMTEEQEMDKE
EADSPAEGEKTPEKDERAPEGCEREPEQDREEPEEGRDPEPEKAEDRAIEDSSRISDENE
KIEGIEKNGETLSIQILPENKLAPQGSGKRNKVRTDSRQGRYIRYRFLHGPLQDIAFDAT
FRAAAVKQAYRDKGELALAVRSEDLREKVREKRTGATLLFVVDASGSMGAKRRMGAVKGA
ILSLLNDAYQKRDSIGMIAFRKDGAEVLLNITRSVDLAQKCLETLPTGGKTPLAAGLAKA
YELLKVDRIKNPEALQYIILVSDGKANLPLFSDQALKDALIVGKKIRHEGIRSMVLDTEN
SYIQFGFAKELADAMGSVYLKLQNITRTEIESTVKNVLKGT
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttataactgctttccttttgccgctgtctgcggtcaggaaaaagtaaaaaag
gccctgatcctcgctgccatcaaccccaggatcggaggggtcctgatcagcggtgaaaag
ggaacggccaaatccaccctggtcagggggcttgcccagatcatggaagataccgacctg
atcaatctgcccctaaatattacggaagaccggctggtgggcagtatcgacatggggaaa
gccattcaatatgggcaaaaggaactggaggaaggactacttaaaaaagcccatgggcag
ttcctctatgtggatgaagtcaatctcttaagccctcatatcgccggcattcttttggaa
gtggccgccactggagtcaatatcattgagcgggaggggatctcccacagccatccggcc
cggttcgtcctggtgggttccatgaatccggaggagggtattctaagcccccaattcctg
gaccgctttggactttatatggaagctaaaggggagaaggagaaagctgtcaggacagag
attatgcaaagaagactggcttatgagcaggatcccgaggggttctgcactcagtggcag
gaggccggtcaggtcctggcccggcggatcaaaagcagcaaaagcatgcttaaagaggtc
caagtgccggaagagggatataagttggcggcggagctggctaaagcaggccgctgcgcc
ggacacagagcggaaattatcctggtggagacggccagagccttagcggcgctggctcag
cgaaccgaactgacggccggggatatccgggaggccgcgacttacgtgctccctcaccgc
ttgcgggaatccctggccattgaggaagtgatgacagaggaacaggagatggacaaggag
gaagcagattccccggcagagggtgaaaagactccggaaaaggatgaaagggctccggaa
gggtgtgaaagagagccggagcaggatagggaagaaccggaagagggaagagaccctgaa
ccggaaaaagcagaggacagggcgattgaagactccagccggattagtgatgaaaacgaa
aaaatcgaagggatagaaaagaatggggagaccctatccattcagatccttccggaaaat
aaattggcaccccaaggcagcggcaaaagaaacaaggtcaggacggacagccgccaggga
cgctatatcagatacaggtttttgcacggccccctccaggatattgcctttgatgcaact
ttcagggcggcagccgtcaagcaggcctatcgggacaagggagagctggccctggccgtc
aggtccgaggatctgagggaaaaggtcagagagaagcggaccggagccacgctgctgttt
gtggtggatgccagcggttccatgggggccaagaggcgcatgggagccgttaagggagcc
atcctgtccttgctgaacgatgcttatcagaaacgggacagcatcggtatgatcgccttc
agaaaagacggggcggaggtcctgctcaatattacccggagtgttgatctggctcaaaag
tgtttggagactttgcctacaggaggaaagacccctctggcggcaggtttggccaaggct
tatgagctgctaaaagttgatagaatcaagaacccggaagctctgcaatatattattctg
gtgtccgacggcaaggctaatctgcctctgttcagtgatcaggccttaaaggatgctcta
atcgtcgggaaaaaaatccgccatgagggcatcagaagtatggttctggatacggaaaac
agctatattcaatttggctttgccaaagaactggctgatgctatgggcagtgtttatcta
aaactgcagaatataaccagaacagagattgaaagtactgtaaaaaatgtgcttaaaggg
acttag

DBGET integrated database retrieval system