KEGG   Desulfitobacterium hafniense Y51: DSY4329Help
Entry
DSY4329           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DSY4329
Enzymes [BR:dsy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     DSY4329
Peptidases [BR:dsy01002]
 Cysteine Peptidases
  Family C44
   DSY4329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4926548..4928401
Genome map
AA seq 617 aa AA seqDB search
MCSILGLVNFKRKISPQEIQCLSTMGKTLIHRGPDQNGLEYGEHFAFQHNRLAIIDIEKG
RQPMTATHQGYDYTIVYNGELYNTADLRQELLEHGVKFKTYCDTEVVLYAYIIWGEQCSS
KLNGIYAFVIYDSKEKKTYLSRDRFGVKPFFYTFVEGALLFASEIKALLKHPQVKPRLDY
QGLWQLLYMMPVKEEGTAIFKDIFELPTASHAFYSLAPGASEAELKIAKYWTMEAYENQD
SEAAIVATTRDLLVDAIERQLVSDVPLCTFLSGGLDSSIITAVAAQKYQAEGRQLATYSF
EHEGNKDHFKQTLFQPQSDDEFAVYLAQHLHTQHQILTAKKEHLVDYLDEAVRYRDYPGM
ADIDSSLLFYCRQVKEHHTVALSGECSDEVFGGYPWFYRPEMLTRGFFPWIHEPHARISL
FKPELVRPQEGFAYTSEIYRRSVEACPLLPDESETMQNSRIASWLSINYFMTSLLERKDR
MSMASGLEVRVPFSDHRLVQYVYNVPWEIKFKDGVEKALLRAAMQDYLPPKILYRKKSPF
PKTHDPHYEELVFHLFRKRLDSGSGMLAELLQKDVLNRLISPGNNTWFGQLMGLPQLLAW
LVQLDYWFEAYQVQLVG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccattcttggattagtaaattttaaacggaagatttctccccaggagatacaa
tgccttagcactatggggaagactttaattcatcggggtccggaccaaaacggccttgaa
tacggagaacattttgcttttcaacataaccgtttagccattatcgatattgaaaaaggc
cggcagcccatgaccgccacccatcagggatacgactataccattgtttacaacggcgaa
ctttacaacaccgcagatttacggcaagagctccttgagcacggagttaagttcaaaact
tactgtgatacggaagtagtgctctatgcctatatcatctggggagaacaatgctccagc
aaattaaacggcatttacgcctttgtaatctacgattctaaagaaaaaaagacctatctt
tcccgtgaccgcttcggcgtcaaacccttcttctacacttttgtagagggcgctcttctt
ttcgcttcggagatcaaagccctcctcaagcaccctcaagtgaaaccccgtctggattac
cagggtttatggcagctcctctatatgatgcctgtcaaagaggaaggcaccgccatcttt
aaggatatcttcgaattgcccaccgcctcccatgctttctatagccttgccccaggagca
tctgaagcagagttgaagatcgccaaatactggaccatggaggcttatgagaatcaggac
agcgaagctgctatcgtcgccaccacccgggatctgttggtggatgccattgaacgtcag
ctggtctccgatgtccctctttgcactttcctttccggaggattggattcttcaatcatc
accgccgtggcagcgcaaaaatatcaagccgaaggacggcagcttgctacctattccttt
gaacatgaaggcaataaagaccattttaagcagactcttttccaaccgcaaagtgatgac
gagtttgccgtttatctggctcagcacctgcacacacagcatcagattctgaccgctaaa
aaggagcatttggtggactacctggatgaagccgtaaggtatagggactatcccggcatg
gcagatatcgattcctccctgctcttttattgccgtcaggtaaaagaacaccacacggtg
gctttatccggagaatgctctgatgaagtcttcgggggctacccctggttttatcgtccg
gaaatgctcacacgggggtttttcccttggatccacgaaccccatgcccggattagtctg
ttcaagcctgaactggttcgcccccaggagggctttgcgtacacttcggagatttaccgc
cggagcgtcgaggcctgccccttgcttccagatgagtcggagactatgcagaactcccgc
atcgccagctggctttccattaattactttatgacctccttgctggaacgcaaagatcgc
atgagcatggcttcgggcttggaagtccgggttcctttctccgatcaccgcttggttcag
tacgtctataatgtgccatgggagattaaattcaaggatggcgtcgaaaaggcactgctt
cgggccgccatgcaggactatctgcctcctaaaatcctctatcgtaaaaaaagccccttc
cctaaaacccatgatcctcattatgaagagctggtattccatcttttccggaagcggctg
gactccggcagcggcatgctggcagagctattgcaaaaggatgtgctcaatcgccttata
agtcctggaaataacacctggtttggccagttgatggggcttccgcaattgctggcttgg
ctggtgcagctggactattggtttgaagcctaccaggtgcaattggtaggctaa

DBGET integrated database retrieval system