KEGG   Desulfitobacterium hafniense Y51: DSY4404Help
Entry
DSY4404           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dsy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:dsy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5006773..5008299
Genome map
AA seq 508 aa AA seqDB search
MALSLATGAVLDSRPASVVAAQPAATAKAEVTEKTPKYIFMFIGDGMAAVQVNSAQIYGG
TNKHNQMALDKMNFQDFEAVGYQTTQDATSFAPDSASTATSLSSGFKTWSGTIGLKPVGS
KSGNKPENVEGTIPKTIAERLKAEKGMKIGIISTVTINHATPAAYYAHVASRNDYYDIAL
QMADSGFDFFGGGTISQPTGKDKDQKDAYDVMKEKGYKIAKTKEDILALNSQSGKAYAVT
PVTQDSGAMPYAIDNKDGDLTLADFVKKGIDVLDNDKGFFMMAESGKIDWAGHANDAKAN
IGDVIAFEEAIQVAIDFAAKHPEETLIIVTGDHETGGMTIGQATTGYDTAFHILESQKIS
YVAFDALINKMKADNPSLKFDDVMPVITESFGLVNKTKNDISRPGEPSYMTLELSDREVA
KLKKAFMETMKDKPTDSEENDLLYGGYNPLSVTLTHILNNKAGIGWTSYSHTGVPVPVYA
TGAGAELFNGAYENTAVYDKLVKATNIN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggccttatctctggccacaggtgccgtactcgatagcaggccggcatcagtagtggca
gcacagcctgccgcaacagccaaagccgaagtaacagaaaagacccccaagtatatcttt
atgttcatcggggatggcatggcagccgtacaagtgaactcagctcaaatttacggcgga
accaataaacataatcaaatggctttagacaaaatgaacttccaggattttgaggccgtt
ggttatcaaaccactcaggacgccacatcctttgcaccggactctgcatccacagcaact
tccctttcctcaggatttaagacctggagcggaaccattggcctaaaaccggtgggaagt
aaatccggaaacaaaccggaaaatgtggaaggtacgattcccaaaaccattgccgaaaga
cttaaggccgaaaaaggaatgaagatcggcatcatttccaccgtaaccatcaaccatgcc
acaccggcagcttactatgcccatgtcgcttcccgaaacgactattatgacatcgctctg
caaatggcagattccggcttcgatttctttggcggcggaaccatcagccagcctacagga
aaagacaaagatcaaaaagatgcttatgacgttatgaaagaaaagggctacaaaatagct
aagacaaaagaagatatcctggcccttaacagccaatcaggaaaagcctatgcagtgact
ccggttactcaggacagcggcgctatgccctatgccatagataataaagatggcgattta
actctggctgatttcgtaaaaaaaggcatcgatgttcttgacaacgacaaaggattcttc
atgatggccgaatcaggcaagattgactgggcaggtcatgctaatgatgccaaagccaat
attggtgatgtgatcgcctttgaagaagctatccaagtcgccatcgactttgctgccaag
caccctgaagagaccctgatcatcgttaccggcgatcatgaaacaggcggcatgaccatc
ggacaggcaacaaccggttatgatacagcttttcatattttagaaagccaaaagatatct
tatgtagcctttgacgctttaatcaataagatgaaagcagacaatccgtccctaaaattt
gacgacgttatgccggttatcacggaaagcttcggtcttgttaacaaaaccaaaaatgat
ataagccgccccggtgagccaagctatatgactttagagctatctgatcgggaagtagct
aagctgaaaaaggcctttatggaaaccatgaaagacaaacctaccgacagcgaagaaaat
gatctattatacggcggttataatccactttccgtaaccttaactcatattcttaataac
aaagcaggtatcggctggacctcctattcccacacaggagtaccggttccagtctatgca
acaggtgctggtgccgagttgtttaatggtgcctatgaaaataccgctgtgtatgacaaa
ttagtcaaggctacaaatattaactag

DBGET integrated database retrieval system