KEGG   Desulfitobacterium hafniense Y51: DSY4462Help
Entry
DSY4462           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DSY4462
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DSY4462
Enzymes [BR:dsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DSY4462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5066917..5068284
Genome map
AA seq 455 aa AA seqDB search
MTKTPYKIYLSEEEMPKSWYNLKAVMKELPPPMLHPGTLKPCTIEDLQPVFCDELIEQEL
NTKDLYIEIPEDIRDFYKMYRPSPLVRAYCLEKLLDTPAEIYYKFEGTNTSGSHKLNSAA
AQVYYAKKQGLTSLTTETGAGQWGTALSMACAYYQIDLTVYMVKISSEQKPYRKAVIETY
GGKVIPSPSDTTEIGKKILAENPGTGGSLGCAISEAIEVALKSENCRYVLGSVLDHVVLH
QTVIGEETKIACEKYGIQPDIMIGCVGGGSNYAGLIAPFFGDKLQGKNNITFIGVEPASC
PSLTRGKYAYDFGDTGKTTPLLKMYTLGSGFIPSPNHSGGLRYHGMSGIVSKLYHDGLME
ARAVEQSKIFDAATLFARSEGILPAPESSHALRVAIDEALKCKETGEKKTILFGLSGTGY
FDLSAYMNYNAGTMTDFIPTDEDLEKSFATLPKVD
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaacaccttacaaaatctatctctccgaagaggaaatgccgaaaagctggtac
aacttgaaggctgtaatgaaggaactcccccctcctatgcttcaccctggaacgctgaag
ccctgcaccatcgaagatctgcaacctgtgttttgtgatgagttaatcgaacaggaatta
aacaccaaagatctttatattgagatccctgaagatatacgggacttctataagatgtac
cgtccttcacccctggtcagagcttattgcctggaaaagctgctggatactcccgcggag
atctactataaatttgaaggaaccaatacctccggctcccacaaactcaactcagctgcc
gcccaggtctactatgctaaaaaacaaggtttaacttcccttactacagaaaccggcgct
gggcaatggggtacggccctatccatggcctgtgcctattatcaaattgatctcaccgtc
tatatggtgaagatctcctctgaacagaagccctatcgcaaggctgtgattgagacttat
ggtggtaaggtcatcccctctccctccgacaccacagaaatcggaaaaaaaatcctcgcc
gaaaatcccggcaccggcggctccctgggatgcgctatctccgaagccatcgaagtagct
ctaaaatctgagaattgccgctatgtcctgggcagtgtccttgatcatgtggttctccac
caaacagtgatcggtgaagagaccaagattgcctgcgaaaagtacggtattcagcccgat
attatgatcggctgcgtaggaggcggctccaactatgccggcctgattgcccccttcttc
ggagataaactccaaggaaaaaataacattacctttatcggtgtagagcctgcctcttgt
ccatctttaacccggggtaaatatgcctatgattttggcgatacaggaaaaaccactcca
cttcttaaaatgtatactttgggctcaggattcattccctcccctaaccattccggtggt
cttcgctaccacggcatgagcggcatagtatccaagctctatcatgatggccttatggaa
gcccgggcggttgagcaatctaagatcttcgatgctgctactctctttgcccgcagtgaa
ggaattctccctgcccctgaatcctcccacgcgctgcgggtagccatcgatgaagcccta
aaatgcaaagagaccggagagaagaaaaccattcttttcgggctttccggcaccggatac
tttgatctgtccgcttatatgaattataacgcgggcaccatgaccgactttatccctacg
gatgaagacttagaaaagagctttgctactttgcctaaagtagactaa

DBGET integrated database retrieval system