KEGG   Desulfitobacterium hafniense Y51: DSY4810Help
Entry
DSY4810           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DSY4810
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DSY4810
Exosome [BR:dsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DSY4810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5466446..5468032)
Genome map
AA seq 528 aa AA seqDB search
MTEGTAVVFCKTIEIPKDAKFKVKADAGRIRGKTMKKYVLALDQGTTSCRAILFDRESQI
VGVAQKEFTQIYPQPGWVEHDPEEVWSTQYGVIAELLARYQVTSEEIAGIGITNQRETTV
VWDKHTGKSVTNAIVWQCRRTAPLCDELKMKGLEPLFKEKTGLVLDAYFSGTKIRWILDR
VPGAQEKAEKGELLFGTMDTWLVWNLTKGRIHVTDYSNASRTLLYNIKTLAWDPDLLQVL
NIPLAMLPEVKPSSTIYGETAAEGLFGHPIPIAGIAGDQQAALFGQACFAPGMAKNTYGT
GCFMLLNTGEELYESRHGLISTIAWGLDEKVIYALEGSVFMAGAVMQWLRDELKLIETAG
DSEYFAGKVADNGGVYLVPAFTGLGAPYWDMDARGAIVGLTRGSNKNHIIRAALESMAYQ
TRDILEAMEADSQLPLQLLKVDGGAVVNNLLMQFQADILGVEVERPHCIETTALGAAYLA
GLAIGFWSSKEELRDKAKMERSFKPQMAEERKEKYYQGWHKAVRQIME
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaaggtacggctgttgttttctgcaaaacgatagaaatacctaaagatgcgaaa
tttaaagtaaaagctgatgctggacgaataagggggaaaaccatgaagaagtacgtcctt
gccttggatcaggggacaaccagctgccgggccatcctttttgatagggaaagccaaatc
gtcggcgtggcgcaaaaggaatttacgcaaatttacccccagcccggctgggtagagcat
gatccggaagaagtatggagcactcaatacggggtcattgccgagctgctggcccgctat
caagtaaccagcgaagagattgcggggatcggaattaccaatcagcgggaaaccacggtg
gtttgggacaaacatacgggaaagtctgtaaccaatgcgattgtctggcagtgtaggaga
acggctcccctctgtgatgaactaaagatgaaaggattagagcctttgttcaaggagaaa
acaggcttagtcttggatgcctatttttcaggcactaaaatccgctggatcttagatcgg
gtgccgggtgcccaggaaaaggccgaaaagggcgagctgctctttggcaccatggatacc
tggctggtgtggaatctgaccaagggccgcattcatgttacagactactccaatgcctcc
cgcactctcctctataatattaagaccttggcttgggacccggatctgcttcaggtgctc
aatattcctttagccatgctcccagaggtaaagccctccagcactatctacggagagaca
gccgccgagggccttttcgggcatcctattcctattgccggcattgccggggatcagcaa
gcagccctcttcgggcaggcctgctttgcaccggggatggccaagaatacctatggcacc
ggctgctttatgctgcttaatacaggagaagaactctatgaatcccggcatggcctcatc
agcaccatcgcctgggggctcgatgaaaaagtaatctatgccctggagggcagtgtcttt
atggctggagcggtaatgcaatggctgcgggatgaattaaagcttattgaaaccgctggg
gattcggaatacttcgcaggcaaggttgccgacaatggcggcgtttacctggtgcctgct
tttacggggctgggggcaccttactgggatatggacgctcggggggccattgtgggcttg
acccgcggcagcaataaaaatcatatcattcgtgccgctttggagtccatggcttatcag
accagggacattctggaggctatggaggcggattctcaattgcctctccaacttctcaaa
gtggatgggggagcggtggtcaacaacctcttgatgcagtttcaggcagatattttgggt
gtggaagtggaacgcccccattgtattgaaaccacagccttaggagcggcctatctggct
gggctggcgataggattctggagcagcaaagaggaattaagagacaaggcaaaaatggaa
cgctcttttaaacctcagatggcagaggagcgcaaagaaaagtattatcaagggtggcat
aaagccgtcagacagatcatggagtaa

DBGET integrated database retrieval system