KEGG   Desulfitobacterium hafniense Y51: DSY4929Help
Entry
DSY4929           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00030  Pentose phosphate pathway
dsy00051  Fructose and mannose metabolism
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01120  Microbial metabolism in diverse environments
dsy01130  Biosynthesis of antibiotics
dsy01200  Carbon metabolism
dsy01230  Biosynthesis of amino acids
Module
dsy_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DSY4929
   00051 Fructose and mannose metabolism
    DSY4929
Enzymes [BR:dsy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     DSY4929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB Gly_rich_SFCGS
Motif
Other DBs
NCBI-ProteinID: BAE86718
UniProt: Q24MM4
Position
complement(5599026..5599490)
Genome map
AA seq 154 aa AA seqDB search
MEVSLLKIALGADHGGYELKNEIRAHLEEQGIEILDFGTNTKDSVDYPRYGFYVGDAVTK
GKADLGIVVCGTGLGISIAANKVPGVRAAVCTETYSARMAREHNNANILALGGRVTGLGL
ALDIVDMFVKTPFAGGRHACRVDLIDAIEKGETL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttggaggtgtcccttttgaaaattgcattaggagcagatcatggcgggtacgaacttaaa
aatgagattcgtgcccatttagaagaacaagggattgagattctggatttcggcaccaac
actaaagattctgtggattatcccaggtatggtttctatgtaggtgatgcagtgactaaa
ggcaaagcagacttaggaattgtggtctgtggtacgggtttagggatctccatcgctgcc
aataaagtaccgggggttcgtgctgcagtctgcactgagacctattccgcacgtatggcg
cgggaacataataatgccaatatcctggctctcggaggcagagtcaccggtttggggttg
gccttggatatcgtggatatgtttgttaaaactccttttgctggtggacggcatgcttgt
cgggtcgatctcatcgacgccattgaaaaaggagaaactctctaa

DBGET integrated database retrieval system