KEGG   Desulfitobacterium hafniense Y51: DSY4993Help
Entry
DSY4993           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSY4993
   00650 Butanoate metabolism
    DSY4993
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     DSY4993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5662919..5664406)
Genome map
AA seq 495 aa AA seqDB search
MLNFDYDLQSVQETRNLARQAKQAQTELAQFNSEQIDKIIRNMVKVAEENAVALAKLAVE
ETGFGKVEDKVFKNRFASTELYQFIKPMQTIGVIKEDKINKVMEIAEPVGLLMGIVPSTN
PTSTTIYKSLIAIKARNGIVFSPHPSALKCTLEAAKLMNDAAVAAGAPANIIGCISKPSM
NATNELMKCDEVAMIIATGGSAMVKAAYSAGKPALGVGPGNVPAYIERTADIPKAVRNII
ASKTFDNGTICASEQSVVVEECIRNQVMEEFKRQGGYFMTPEETEQVGRKLFNRGHAMNA
KMVGRSAADIAAGAGISIPPGTKVLLGEQQGVGEQYPLSYEKLTTVLAFYTVKDWHEACD
LCMKLLNNGGVGHSLSIHTETPEMAIKFAEKPVFRILVNTASTHGGVGVSTGLAPAFTLG
CGTWGGSATSDNVTPMHLINIKRVAYGIKDVTENGNSSYATGDAQQGGSGGTVSEDRIQA
LVNEVMSLLKQRGDC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaactttgattatgatttacaatctgtgcaggagaccagaaatcttgcccgtcag
gccaaacaagcccagactgaactggcacaattcaatagcgagcagattgacaaaatcatt
cgcaatatggtaaaggtagcggaggaaaatgctgttgctctggcaaagttagcggtggaa
gaaacagggtttggcaaagtggaggataaggtttttaagaatcgttttgcctctacagag
ctctatcaatttatcaagcccatgcagaccatcggggttattaaggaagacaagatcaat
aaggtcatggagattgcggaaccggtgggattgctgatggggattgtcccctccaccaac
cctacctccacgactatctacaaatcgctcattgccattaaagcacgtaacggaattgtg
ttctcaccccatccttcggctttgaagtgcactttggaagcagctaagttgatgaacgat
gcggcagtggcggccggtgctccggccaatatcatcggctgcatctccaagccatccatg
aatgcaaccaatgaactcatgaaatgcgacgaagtagccatgatcattgccacaggcggt
tcggccatggtcaaggcggcctatagcgccggaaaaccggctctgggggtaggcccgggc
aatgttcccgcttatattgaaagaactgccgatattcccaaagcagtcagaaatattatt
gccagcaaaaccttcgacaatggcactatctgtgcttctgagcaatcggtggtggtagaa
gagtgcattcgcaaccaggttatggaagagttcaaacgtcagggcggctacttcatgacc
ccggaggaaactgagcaagtggggcggaaactgtttaacaggggccatgccatgaatgct
aaaatggtggggagatccgctgcagatatcgcagccggtgccggaatttccattcccccg
ggaaccaaagttctgctgggagaacaacagggagtcggcgagcaatatcccctctcctat
gaaaagctgaccacggtgctggccttttataccgtcaaagactggcatgaagcctgcgat
ctatgcatgaaattactcaataacggcggggtaggccatagcctttccattcatacggaa
accccggaaatggctatcaaatttgcagagaaacccgttttcaggattttggtcaataca
gcatccacccatggtggtgtaggagtaagtacaggactggcgcccgcctttaccttaggc
tgcggtacttggggaggaagcgcaacctcagacaatgtaacccctatgcacttgatcaat
attaaacgtgtagcctatggaatcaaagatgtcacagagaatgggaattcctcctatgca
accggggatgcacagcagggcggctccggcggcactgtcagtgaagaccggattcaggct
ctggtcaatgaagtcatgtccctgttgaaacaaaggggtgactgctaa

DBGET integrated database retrieval system