KEGG   Desulfurobacterium thermolithotrophum: Dester_0022Help
Entry
Dester_0022       CDS       T01427                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dester_0022
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dester_0022
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dester_0022
Enzymes [BR:dte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dester_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(19690..20751)
Genome map
AA seq 353 aa AA seqDB search
MKRWKGVIEEFREFLPVTDKTPVVTLLEGNTPLIEANNLAKEIKPGIKLYLKFEGLNPTG
SFKDRGMTMAVSKAVEEGAKAVICASTGNTSASAAAYAAKAGLKAVVLIPEGKIALGKLS
QAVMYGAEVVQIKGNFDEALEIVRKIGAEYPITIVNSINPYRLQGQKTAAFEICEQLGRA
PDYHFIPVGNAGNITAYWMGYKEYFEVGKIDSKPKMCGWQAAGAAPIVLGHPVKNPETIA
TAIRIGNPASWEGAVNAAKESKGFIDMVTDEEILEAYRLVARTEGIFCEPASAASIAGVI
KSVREKDMFEKGDVIVCTLTGHGLKDPDTAISMGVKPVTLPADKNEIVKHLGF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggaaaggagtaatagaagaatttagggagtttctaccagttacagataag
acaccagtagtaacactacttgaaggaaatacccctttaatagaggctaacaacttagca
aaagagataaaacctggaataaaactttatcttaagtttgaaggtctcaaccctacgggc
tcttttaaggatagaggaatgacaatggccgtctcaaaggctgttgaagaaggagcaaag
gctgtcatatgtgcctctaccgggaacacctcagcatctgctgcagcttatgctgcaaaa
gctggactcaaagcagttgttcttattcctgaagggaaaattgcacttggcaaactctct
caggctgtaatgtatggtgccgaggttgttcagataaaaggaaactttgacgaggccctt
gaaatagttaggaagattggagctgaataccctattacaattgttaactcaataaatccg
tacagacttcagggacagaaaacggctgcatttgaaatctgcgagcagcttggaagagct
ccagattaccactttatccctgttggaaacgctggaaacatcacagcttactggatgggg
tacaaagaatactttgaggttggaaaaattgactctaaaccaaagatgtgtggatggcaa
gctgctggagctgctcccatagtcttaggtcatccagtaaaaaatcccgaaacaattgca
acagcaattagaattggaaatcctgcaagctgggaaggagcagtaaacgcagccaaagaa
tctaaaggatttatagatatggtcacagacgaggaaatacttgaagcttacaggctcgtt
gcaagaacagaaggaatattctgcgaaccagcatctgctgcttcaatcgcaggagttata
aaatcggtaagagaaaaagatatgtttgaaaaaggagatgtaattgtctgtacacttacc
ggacatggactcaaagacccagatacagcaatatctatgggagtaaaaccagttacactt
ccagctgataaaaacgaaatagtaaaacacttaggattttaa

DBGET integrated database retrieval system