KEGG   Desulfurobacterium thermolithotrophum: Dester_0039Help
Entry
Dester_0039       CDS       T01427                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dester_0039
Enzymes [BR:dte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dester_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35060..36031
Genome map
AA seq 323 aa AA seqDB search
MGDVLAFGSIVIDNVLVAEKFASINETVLAKKYRYTYGGAGANVAVAVARLGVKSGIFAV
SGYDFEKLNYEKALKEQGVDIRGIIKTKTFPMARSFIISKEKSNDQIIYYYENKKETANL
LFKNEKLALSLIKKYKIVHFSTGHFEFYYHLLKNNNFKTLISFDPGQETFSYSYRVVRLL
KYANLLFMNNHEAKRIKEILKIKSIREIKGPKLICISLGAHGAVVIYRGKLFRIPPVRPI
RLVDPTGAGDSHRAGFLVALLKGYDVLTAGKIASTVASFTIEAEGAQTSLPTWNEVVKRY
EHFFKEKFPKPKRNWEEIKAKLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgggggatgtattagcttttggaagcattgttatagataatgttcttgttgctgagaag
tttgcttctattaacgaaactgttttagcgaaaaagtatagatatacttatgggggtgct
ggagcaaatgtagctgttgcagttgcaagacttggtgtaaaaagcggtatctttgctgtt
tctggttatgattttgaaaaattaaactacgaaaaagctttaaaggaacaaggagtagat
ataagaggaattataaaaacaaaaacatttccaatggcaaggagttttataattagtaaa
gaaaaaagcaacgatcaaataatttattactatgaaaataaaaaggaaacggcaaacctt
ctatttaaaaatgaaaaacttgccttgagtttaataaaaaagtacaaaatagttcatttt
tcaactggtcactttgaattttattatcacttactaaaaaataacaattttaaaacccta
ataagttttgatccaggacaggaaactttttcttattcttacagagtagttagactttta
aagtatgccaatcttctttttatgaataatcatgaggctaaaagaataaaagaaatctta
aaaataaaaagtataagggaaataaaaggtccaaaactcatttgtatttctcttggagct
cacggtgcagtagttatctatagaggaaagcttttccgtattcctcctgttagacccatt
cggcttgttgatccgacgggagcaggagattctcatagagcaggttttttagttgctctt
ttgaaaggttacgacgtgcttacggcagggaaaattgcttcaactgtagcttcttttacg
atagaagcagaaggagcacaaacaagtcttccaacatggaatgaagttgtaaagagatat
gagcacttctttaaagaaaagtttccaaaaccaaaaagaaattgggaagaaataaaggca
aaattgttataa

DBGET integrated database retrieval system