KEGG   Desulfurobacterium thermolithotrophum: Dester_0227Help
Entry
Dester_0227       CDS       T01427                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dester_0227
Enzymes [BR:dte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Dester_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203371..204174
Genome map
AA seq 267 aa AA seqDB search
MVFLGASSQGKLLLFGIPYDSTTCFRPGARFAPDGIRFFSENLETYSPSLDKDLEAVRFR
DLGNVDVPANPEKLIKTVEDFMKNVEIPIMIGGEHSVTYPVVKSLFERYGNLTVIHFDAH
ADLRDEYSGTKYSHACVMKRILELGCNLIQIGIRSGTKEEFELMKNSLQITYLYSPKDLP
EILKSIKTPVYITIDIDFFDPAYAPGTGTPEPCGFSPIEFFETIYKLPPVKVVGFDVVEV
SPPYDPSGITQMLAAKIVRELILKFWG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtttttctcggagcatcctcacaaggcaaacttttactgtttggaataccttacgat
tctacaacctgttttagaccaggtgcaagatttgcccctgacggaattcgatttttttct
gaaaatcttgaaacatacagtccttctttggataaggatttggaagctgtaagatttaga
gatttaggaaacgttgacgttcctgctaatcccgaaaaattaattaagactgtagaagat
ttcatgaaaaacgtagaaattcctatcatgattggaggagagcactctgtaacctatcca
gttgttaaatccttgtttgagcgctacggaaatttaacagttatacattttgatgctcat
gcagatttaagagatgaatattctggaacaaagtactcccatgcctgtgttatgaaaaga
attttagagctcggctgtaatctaattcagattggcattaggagtggaacaaaagaagaa
tttgagcttatgaaaaatagtctacaaattacatatctctattcaccaaaagatttacct
gagattttaaagtcaataaaaactccagtttacattacaatagatatagatttttttgat
ccagcctatgctcctggaacaggaacccctgaaccgtgtggtttttctcctattgaattc
tttgaaaccatttataaattaccgcctgttaaagtagttggatttgatgtagtagaagtt
tctccaccttatgatccaagtggtattactcaaatgcttgctgctaagattgttagggaa
ttgattttaaagttttgggggtaa

DBGET integrated database retrieval system