KEGG   Desulfurobacterium thermolithotrophum: Dester_0275Help
Entry
Dester_0275       CDS       T01427                                 

Definition
(RefSeq) acetate/CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dester_0275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dester_0275
   00620 Pyruvate metabolism
    Dester_0275
   00640 Propanoate metabolism
    Dester_0275
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dester_0275
   00680 Methane metabolism
    Dester_0275
Enzymes [BR:dte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dester_0275
Lipid biosynthesis proteins [BR:dte01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dester_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(262135..264030)
Genome map
AA seq 631 aa AA seqDB search
MSEERLEHLLKQEIVVQPPEEFIENANVKDYEAEYRKFEKDPENFWSSIAKELFWYERWK
KVLEWNYPHARWFVGAKTNITVNALDRHVKNGKRNKVAFFWEDELGNERVVTYGELYRLV
NKLANALKKAGIKKGDRVVIYMPLVVEQIAAMLACARIGAIHSVVYAGFSAPALKHRIED
AEAKIIITADVTIRRGRAIPLKRIVDEAIMELSFIKQVVVLRRLEPKVDLIGEKEVDFYE
FMNGCSDYCEPEVMDSEDPLFILYTSGSTGKPKGVLHTTGGYMVGTYYSMKTVFDLKDND
VYWCTADPGWITGHSYIVYGPLIAGATQVIAEGAPNYPDFGRWWRLIEKYGVNIFYTAPT
AIRMFMKAGEEWPNKYDLSSLRLLGSVGEPINPEAWLWYYRVIGKERCPIIDTWWQTETG
TVMITTIDSLPMKPGKAGKPVPGVVADVVDKEGNPVKADKGGFLVVKYPWPSMMRTIWKN
PKRYEQYWNTIPNCYTAGDVAVKDEDGYIMILGRADDVINVSGHRIGTMEVESALVSHSA
VAEAAVIGIPDPIKGEAIKAFVILKKGYSSSEELVDSLKQHVKAELGAIAVPSKIEFVGK
LPKTRSGKIMRRVLKAKELGIDPGDLSTLED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaaagacttgagcacttattaaaacaggaaatcgtagttcaaccgccagag
gagtttatagaaaatgcaaatgtaaaagactatgaggctgagtacagaaaatttgaaaaa
gatcctgaaaatttttggtcaagtattgccaaagaactcttctggtatgaaaggtggaaa
aaagttcttgagtggaattatcctcatgcgagatggtttgttggagctaaaacaaacata
acagttaatgcccttgatagacacgttaaaaacggaaagagaaacaaggttgctttcttt
tgggaagatgaacttggaaatgaaagagttgttacctatggagagctctacagacttgta
aacaaacttgcaaacgctttaaaaaaagccggtataaaaaaaggagatagagttgttatt
tatatgcctcttgttgtcgagcaaatagctgcgatgcttgcatgtgcacgaataggagct
attcattcggttgtatacgctggatttagtgcaccagctctaaaacacaggatagaagat
gcagaagcaaaaattatcattactgccgatgtaactattagaagaggaagagctattcct
cttaaaagaatcgttgatgaagcaattatggaactctctttcatcaagcaggtagttgtt
cttagaagacttgaaccaaaggttgaccttattggagaaaaagaagttgatttttacgaa
tttatgaacggatgctctgattattgtgaacctgaagtgatggattcagaagatcctctt
tttattctctacacttccggctctacaggtaaacccaaaggtgttctacatacgacaggc
ggctacatggttggaacttattattccatgaaaaccgtttttgatttaaaagataatgat
gtctattggtgtactgcagacccaggatggatcacaggtcacagctacattgtttatgga
cctcttattgccggagctacacaggttattgcagaaggagctccaaattatccagatttt
ggaagatggtggagattaatagaaaaatatggtgtaaacatcttttatactgccccaact
gctattaggatgtttatgaaagcaggagaagagtggcctaacaagtatgatctttcttcc
ctaagacttcttggttctgttggtgaacctatcaaccctgaagcatggctgtggtactac
agagttattggtaaagaaagatgtccaattattgatacttggtggcagactgaaacaggt
actgtaatgattacaacaatcgatagtcttcctatgaaaccaggtaaagcaggtaaacct
gttcctggtgtagttgcagatgtcgttgacaaagaaggaaatcctgtaaaagcagataaa
ggaggatttcttgttgttaagtatccttggccttcaatgatgagaactatatggaaaaat
cctaaaagatacgagcagtactggaacactattccaaactgttatacagctggagatgtt
gcagttaaagatgaagacggatacataatgattcttggtagagcagatgacgttatcaat
gtttctggacatagaattggaacaatggaagttgaatctgctcttgtttctcattcagca
gttgcagaagctgcagttataggtatacctgatcctattaaaggagaagcaattaaggca
tttgtaattttgaaaaaaggttacagttcatctgaagagctggttgatagtcttaaacag
cacgttaaagcagaacttggagctattgcagtaccgtctaagattgaatttgtagggaaa
cttccaaaaacaagaagtggaaaaattatgagaagagtgcttaaggctaaagaacttgga
attgatccaggagatctttcaactctcgaagattaa

DBGET integrated database retrieval system