KEGG   Desulfurobacterium thermolithotrophum: Dester_0326Help
Entry
Dester_0326       CDS       T01427                                 

Definition
(GenBank) peptidase M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00300  Lysine biosynthesis
dte01100  Metabolic pathways
dte01120  Microbial metabolism in diverse environments
dte01230  Biosynthesis of amino acids
Module
dte_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Dester_0326
Enzymes [BR:dte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Dester_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Sigma70_r2 Cation_ATPase
Motif
Other DBs
NCBI-ProteinID: ADY72982
UniProt: F0S239
Position
311040..312101
Genome map
AA seq 353 aa AA seqDB search
MPVSLLQKLISIPSVYGNEKEIADFVENFIKEKNSKLSVIRENNTIVAYTHFESKKKTIA
LVGHLDTVPGENDYTGQIINGKLYGLGTSDMKAGDAVMLKLIEDFAFKSSKYNLFFIFYE
KEEGPYLDNGLRQIFDRYLDLLKKIDFAFVLEPTDNVVQVGCLGVIHAWFKFKGKRAHSA
RPWEGHNAIHKGWKLLKFLNELEPVEYKVGKLSYFEVLNATMTEFKGGRNIIPEEFKVNL
NYRFSPTKTLEEAKEDLLKIKEQIEADEIEFTDLSPAARPCIDNPILVEFLKRFNLPIEP
KQAWTDVAQFSYHGIDAVNFGPGQPHQAHQKNEYVEIEKVKECYEMLYAFLKD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccagtctctctcctccaaaagcttatatctatcccttctgtttatggaaacgaaaag
gaaattgctgatttcgttgaaaattttataaaagaaaaaaattctaagctttcagtaatt
agggaaaataacaccatagtagcttacactcattttgaatctaaaaagaaaacgattgct
cttgtaggacatcttgacacagttccaggagaaaatgactacacagggcaaataattaat
ggaaaactttacggtcttggcaccagtgatatgaaagctggtgacgcagttatgcttaaa
ttgattgaggactttgcatttaaaagttcaaagtacaatcttttttttattttttacgaa
aaggaagagggaccttatcttgataatggtctaagacaaatatttgatagataccttgat
ctcttaaagaaaatagactttgcctttgtccttgagcctaccgataatgtcgtccaggtt
gggtgccttggggtaattcacgcctggttcaaattcaaaggtaagagagctcattctgca
agaccctgggaagggcataatgctattcacaaaggttggaagcttttaaagttccttaat
gaacttgaacctgttgagtacaaagttggaaagctttcctactttgaagttctcaatgca
acaatgaccgagtttaaagggggaagaaacataattccagaagaatttaaggttaatctt
aactacagattttctccaacaaaaacattagaagaagctaaagaggatctacttaaaata
aaagaacagattgaagcagatgaaattgaatttaccgatctctctcctgctgcaagacct
tgcatagataatccaattttagttgagtttctcaagaggtttaatcttcctattgagcca
aaacaagcttggacagatgttgcacagttttcctatcacggaatagatgctgttaacttt
ggtcccggtcaaccacaccaagcccaccaaaaaaacgaatatgttgaaatagaaaaagtt
aaagaatgttatgagatgttgtatgcgtttctgaaagattaa

DBGET integrated database retrieval system