KEGG   Desulfurobacterium thermolithotrophum: Dester_0338Help
Entry
Dester_0338       CDS       T01427                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dte00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322485..322880
Genome map
AA seq 131 aa AA seqDB search
MKVVLILGTNLGNRLDNLKRAEELIEKFVGRILRKTEIIETAPFGVVNQPSFLNYGLLID
TYHPPSELLKLLKWIEKRVGRYKTFRWGPRVVDIDIIKYENLFINTKSLKIPHPGLQHRA
FFVKIYKCLSI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagttttaatacttggaacaaatcttggtaatagattagataatcttaaaaga
gctgaagaacttatagagaagtttgttggcagaattttaaggaaaactgaaataattgaa
acggccccttttggtgttgtcaatcaaccctcttttcttaactatggtcttcttatagat
acctatcatcctccttctgaacttctgaaactccttaagtggatagagaaaagagtagga
agatataaaacttttagatggggtccaagagttgtagatatagatattattaagtatgaa
aacctttttattaatactaaatcgttaaaaattcctcatccaggtctccaacatagagca
ttttttgttaagatttataaatgtttatcaatttga

DBGET integrated database retrieval system