KEGG   Desulfurobacterium thermolithotrophum: Dester_0365Help
Entry
Dester_0365       CDS       T01427                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dester_0365
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dester_0365
Enzymes [BR:dte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Dester_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(357164..358432)
Genome map
AA seq 422 aa AA seqDB search
MEKFVIKGGRKLYGKIRISGSKNASLPILFSSILTGRLKLSNVPDLKDVTTTCYLLQKMG
FEIEKNKDVVEIESGKVIKTEAPYELVKTMRASILCLGPLLAKYGKAKVSMPGGCAIGLR
PVNLHLKALSKMGADIRIDHGYITAEVKGRLKGCEITFDFPTVGGTENVLMAAVLADGKT
IIRNAAKEPEIVDLAKALKKAGAIIEGEGTDVIEITGISELEEIDYRVMPDRIEAGTFVA
AVGLAGGEIELEEFPFEVLKAVIEKFEEAGLKIEKLDKNRAKVKKVGKLKGTDIITQPYP
GFPTDMQAQFMATMCLAEGVSVIKETIFENRFMHVLELQRLGADISIDGNTVVIKGVDKL
IGAKVTATDLRASASLVIAGLAAENTTEVYRIYHLDRGYERMEEKLQALGANIKREKSEL
PY
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtttgttataaaaggtggaaggaagctttatggaaagattcgaatatctggt
tcaaagaatgcatctcttccaatcctattttcttctatattgactggaagacttaaactt
tcaaatgttcctgatttaaaagatgtaacaactacttgttatttgcttcaaaaaatggga
tttgaaattgagaaaaataaagatgttgttgagattgaaagcgggaaagtcataaaaaca
gaagctccctatgagcttgttaaaactatgagggcatctatcctttgcttgggacctctt
cttgcaaaatacggtaaagctaaggtttctatgcctggtggttgtgcaataggtttaaga
cctgtaaaccttcatcttaaagctctttcaaaaatgggagcagacataaggatagatcat
ggttatataacggcagaagtaaaaggaaggctaaaaggatgtgaaataacttttgacttc
cctactgtagggggaacggaaaatgttctcatggctgcagttcttgcagatggaaaaacc
atcataagaaatgctgcaaaagaaccagaaatagttgatttagcaaaagctttgaaaaaa
gctggagcaattatagaaggagaaggaacagacgttatagaaataacagggatttctgaa
cttgaagaaatagattatagagtaatgccagataggattgaagcgggaacatttgttgca
gcagttggtcttgcaggtggagagatagaattagaagagtttccatttgaagttttaaaa
gcagtaatagaaaaatttgaagaagcagggctaaagatagaaaagttggataaaaacaga
gcaaaagtaaaaaaagtaggaaaacttaagggtacagacattattactcaaccttatcct
ggatttccaactgacatgcaagctcaattcatggcaactatgtgtcttgcagaaggagtt
tctgttataaaggaaaccatctttgagaatcgttttatgcatgttcttgaacttcaaaga
cttggagctgatatttcaatagatggaaacacagtagttataaagggagtagacaagtta
attggagctaaagttacagctacagatctaagagcaagtgcttctcttgttatagcagga
cttgctgcagaaaatacaactgaagtttatagaatttaccatcttgatagaggatatgaa
aggatggaagaaaagctccaagctctcggagctaatataaaaagagaaaaaagtgaactt
ccatactaa

DBGET integrated database retrieval system