KEGG   Desulfurobacterium thermolithotrophum: Dester_0390Help
Entry
Dester_0390       CDS       T01427                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dester_0390
Enzymes [BR:dte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Dester_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
389500..390708
Genome map
AA seq 402 aa AA seqDB search
MFITIREFKDKEELKNYLLSIGITEAGVKILSSKVSKFNIEISNIDTRAANILKQDAISV
GGDCAVPRKASIFEKGTCTVLLMVTERSLFRLIEKLKLQPFKLKELAVKLKEAVENYQKD
EFIISYNGKELKLRKPAIMGILNVTPDSFSDGGKFSTVDRALKHCEEMLESGADIIDVGG
ESTRPGSDPVPIEEELRRTIPVIEEIRKKLGNEFFISIDTYKSEVAKKALEAGADIVNDI
SGFHFDKNMAVLVAEKGCPAIVMHIKGTPKDMQKNPYYENVIREILLYFEKTLKEAEKKG
VKREQLIIDPGIGFGKRLEDNLCILRRLSEFKTLGLPILIGTSRKSFIGTITGESDPKKR
LEGTLASVYASVIRGAKIVRVHDVKETKKFLDTLWALEEVYC
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaataagagaatttaaagataaagaggaattaaaaaactatcttctatca
attggaattactgaagcaggagtaaaaattctttcgtcaaaggtttctaagttcaacata
gagatatctaatattgatacgcgagctgcaaatatccttaaacaggatgctatatctgtt
ggtggagattgtgctgttccaagaaaggcttcgatttttgaaaaaggaacatgcactgtt
ttattaatggtaacagaaagaagtctttttagattgattgaaaaactaaagctccaacct
tttaagcttaaagaactagcagttaaactaaaagaagcagtagaaaactatcaaaaagac
gagtttataatcagttataacggtaaagaactaaagttaagaaaaccagcaataatggga
attttaaatgttactcctgactctttttccgatggaggaaagttttctactgttgataga
gctttgaaacactgcgaagaaatgcttgaaagtggtgctgatataatagatgtaggtggg
gagtcaacaagacctggttctgatcctgtaccaatagaagaagaactaagaagaactatt
cctgttattgaagaaataagaaaaaaacttggaaatgaattttttatatccatagatacc
tataaatcggaagtagcaaagaaagctcttgaagccggtgcagatatagttaacgatata
agcggttttcactttgataaaaacatggctgttttagtagcagaaaaaggctgtcctgca
attgttatgcatataaaaggaactccaaaggacatgcaaaaaaacccttattacgaaaat
gttataagagaaatccttctttacttcgagaaaacactaaaagaagcggagaaaaaagga
gtaaagagagagcaattgataatagatccaggcataggttttggaaaaaggttggaagat
aacctatgtatcctaagaagactttcagagtttaaaacactaggacttccaattcttatc
ggaacttcaagaaagagctttatcggaacaattacaggtgaaagtgatcctaaaaaaagg
ttagaaggaactcttgcatccgtttatgcctcggtaattagaggcgcaaaaatagtaaga
gttcacgatgtaaaggaaacaaagaaatttcttgatactctatgggcactagaggaggtc
tattgttag

DBGET integrated database retrieval system