KEGG   Desulfurobacterium thermolithotrophum: Dester_0479Help
Entry
Dester_0479       CDS       T01427                                 

Definition
(GenBank) Nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00760  Nicotinate and nicotinamide metabolism
dte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Dester_0479
Enzymes [BR:dte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Dester_0479
    3.5.1.-  
     Dester_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ADY73133
UniProt: F0S2R1
Position
481667..482245
Genome map
AA seq 192 aa AA seqDB search
MVKVTYCDALIVVDVQKDFLPGGALPVPEGDKVIGPLNRYIELFVSKGQPIFATRDWHPE
NHISFKENGGLWPKHCVQWSEGACFAKELNLPPDTFIINKGDRPELEAYSGFQGTLLDTL
LRERGIKRVFIGGLATDYCVKNTVLGALNLGYVVFFLEDASRGVDVTLGDSKRAKEEMLE
KGAIALKFEDLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggtaacctattgtgatgctctcatagtcgttgatgttcaaaaagattttctt
ccaggaggagctctacctgttccagaaggtgataaagttattggaccgctgaatagatac
atagagctttttgtttctaaaggtcaacctatttttgcaactcgggattggcatcctgaa
aaccacatttctttcaaggaaaacggaggtctttggccaaaacactgtgtacaatggagt
gagggagcttgctttgcaaaagagcttaatcttccacccgatactttcataataaacaaa
ggagatagaccagaacttgaagcgtattcaggttttcaaggaacacttcttgacacctta
ctacgagaaagaggaataaaaagagtatttattggtggattagcaacagactactgtgta
aagaacactgttttaggagctttaaacttaggatatgttgttttctttttagaagatgca
tcaagaggagttgatgtgaccttaggagacagtaaaagagcaaaagaagaaatgttagaa
aaaggagcaattgctttaaagtttgaagatttaaaataa

DBGET integrated database retrieval system