KEGG   Desulfurobacterium thermolithotrophum: Dester_0527Help
Entry
Dester_0527       CDS       T01427                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dester_0527
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dester_0527
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dester_0527
Enzymes [BR:dte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dester_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
535452..536660
Genome map
AA seq 402 aa AA seqDB search
MYNYPDSKGKFGIYGGKFVPETLMAALSELEENYYKIKNDSSFQEEFNKLLKEYVGRPTP
LQYAKRFSQYLGNGIKVYLKREDLNHTGAHKINNALGQALLAKRMGKKKIIAETGAGQHG
VATATACAFLGLECVVYMGEEDVRRQALNVFRMELLGAKVEVVKSGSRTLKDAVNEATRD
WVTNVRTTHYIIGSAVGPHPYPEMVRDFQSVIGREAKEQILEAEGRLPDTIVACVGGGSN
AIGIFYPFIEDESVKLIGVEAGGYGLDTDKHAATLCKGTVGILHGAKSYLLQTEDGQVTP
THSVSAGLDYPGVGPEHSLLKDIKRAEYYAVTDDEALEAFQILSRTEGIIPALESSHAIA
WVIKHKEDLKDQLVVINLSGRGDKDVNQVREILEEREDLRLW
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgtataactatccagatagtaaggggaaatttggaatatacggtggaaaattcgttcct
gaaactttgatggcagctctttcagaactcgaggaaaactattacaaaatcaagaacgat
tcatcattccaagaagagttcaataagctacttaaagaatacgttggacgtcctacacct
ttgcaatatgccaaaagattttcgcaatatcttggaaatggaattaaagtttatttaaag
agagaagatttgaatcatacaggagctcacaagataaataatgccttaggtcaggcactt
cttgcaaaacgtatgggtaaaaagaaaataattgccgaaacaggagctgggcagcatgga
gttgcaacggctactgcctgtgcgtttttaggtttagagtgtgttgtctacatgggagaa
gaggacgtaaggagacaggctctaaacgtttttagaatggaacttcttggtgctaaggta
gaagttgtaaaaagcggtagcaggactttaaaagatgctgtaaacgaagcaacaagagat
tgggtaacaaacgtaaggactactcactatataatcggttcagcagttggtcctcatcct
tatcctgaaatggttagagatttccaatctgttattggaagagaagcaaaagagcaaata
ttagaagctgagggaagattaccagacaccattgttgcctgtgtcggtggaggaagtaac
gcaataggaattttctatccgttcattgaagatgaatctgtaaaacttatcggcgttgaa
gctggtggatacggccttgacacagataaacacgctgcaaccctgtgcaagggaacagta
ggaattctccacggtgctaaatcctatcttcttcaaaccgaagatggacaagttactcct
actcactcagtttctgcaggtcttgattatcctggagttggtcctgaacactctctttta
aaggatataaaaagagcagaatattatgcagtaactgacgatgaagctcttgaagctttt
cagattctttcaagaacagaaggaattattccagcccttgaaagctcccatgcaattgcc
tgggtgataaaacataaggaagacttaaaagatcaacttgtagttattaacctttcagga
cgtggagataaagacgttaatcaagttagagaaatacttgaagaaagagaagatcttcgc
ttatggtag

DBGET integrated database retrieval system