KEGG   Desulfurobacterium thermolithotrophum: Dester_0552Help
Entry
Dester_0552       CDS       T01427                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dte00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(562309..563049)
Genome map
AA seq 246 aa AA seqDB search
MSVRVFFSANLKENQKEILKKTGFEPVSIPLIKTVPFEFSAEEVLKFSPNFTVISSKNGV
KHFFSKISPEKIRSSKFIAVGSSTAEKLKEIGIESLVPENFSGEGLVELLKTINLTGKRF
LIVRPKVARKVVSEFLREKGAEVKEVVVYETIVNEDIKEDLIAEIEKGFEILAFTSPSNF
KSFLKLTGEKGKVILNEGKIIPIGHVTQKAIEKLGFKTWKLPSNYTIDGILNLILQGGSD
ANREIS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaagagtatttttttcagcaaatttaaaagaaaatcaaaaagaaattcttaaa
aagacaggctttgagcctgtctcaattcctcttataaagactgttccttttgaattttcc
gctgaggaagtactcaagttttcgcctaattttacggtcatttcaagcaaaaatggagtt
aaacatttcttttcaaagatttctcctgagaaaattagaagttcaaaattcattgcagtt
ggaagttcaactgcagaaaaacttaaggaaataggcatagaatctttagtccccgaaaac
tttagtggcgaaggacttgtagaactccttaaaactatcaacctaacaggtaaaagattc
cttatcgtaaggccaaaagttgccagaaaagttgtttcagaattcttaagagaaaaggga
gcagaggttaaagaagtagttgtctatgaaactatagtaaacgaagatataaaggaagac
ttgatagcagaaatagagaaaggttttgaaatattagcttttacaagcccttccaacttt
aaatcttttttaaagcttacaggtgaaaaaggaaaagtaattctaaatgagggaaaaatt
attcctataggtcatgtaactcagaaagcaatagaaaaattaggttttaaaacttggaaa
ttaccttcgaattacactattgatggaattttgaatttaattcttcaaggaggcagcgat
gctaatagggaaatttcctga

DBGET integrated database retrieval system