KEGG   Desulfurobacterium thermolithotrophum: Dester_0584Help
Entry
Dester_0584       CDS       T01427                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00010  Glycolysis / Gluconeogenesis
dte00051  Fructose and mannose metabolism
dte00562  Inositol phosphate metabolism
dte01100  Metabolic pathways
dte01110  Biosynthesis of secondary metabolites
dte01120  Microbial metabolism in diverse environments
dte01130  Biosynthesis of antibiotics
dte01200  Carbon metabolism
dte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dester_0584
   00051 Fructose and mannose metabolism
    Dester_0584
   00562 Inositol phosphate metabolism
    Dester_0584
Enzymes [BR:dte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dester_0584
Exosome [BR:dte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dester_0584
  Exosomal proteins of bladder cancer cells
   Dester_0584
  Exosomal proteins of melanoma cells
   Dester_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADY73235
UniProt: F0S313
Position
complement(590489..591244)
Genome map
AA seq 251 aa AA seqDB search
MRRFLIAGNWKMHKTVSEAIELVRELKNLVKDVSDRDILICPPFTALYPVSKELEGSNIT
LGGQNMYFEEQGAFTGEISPLMLKSVGCSYVILGHSERRHIFGESDELINKKVLSSINHG
LIPILCVGELLEERENGKTKEVVEEQIREGLKNVNKDAEFVIAYEPVWAIGTGKTATPEL
AEEVHLFIREVLSDMFGNEKASSVKILYGGSVKPENAAGLLKMENIDGALVGGASLKAES
FAKIVKFDMEA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagacggtttctaatcgctggaaactggaaaatgcataaaacagtttctgaagctata
gagcttgttagagaattaaaaaatcttgttaaagatgttagtgatagagacattctaata
tgtccacctttcacagctctttatccagtttctaaagagcttgaaggttcaaatattact
cttggtggacaaaacatgtactttgaagaacagggagcttttacaggagaaatttctcct
ttaatgctcaaaagcgtaggatgttcttacgttattcttggacactctgaaagaagacac
atttttggtgaatcagacgaactgataaataaaaaagttctttcttccattaatcatggt
ctcattccaatactttgtgttggtgaacttttagaggaaagagaaaacggaaaaacaaaa
gaagttgtggaagaacagataagagaaggcctaaaaaatgttaacaaagacgctgaattt
gttatagcttacgaacctgtttgggcaattggaactggtaaaacggcaactcctgagtta
gcagaagaagttcatttgttcattcgcgaagtactttctgatatgtttggaaatgaaaag
gcaagttctgtgaaaattctttatggaggaagtgtaaagcctgaaaatgctgctggtctt
ttaaagatggaaaatattgatggagctctcgttggaggagcaagtcttaaagctgagagc
tttgcaaaaatagttaagtttgatatggaggcgtga

DBGET integrated database retrieval system