KEGG   Desulfurobacterium thermolithotrophum: Dester_0584Help
Entry
Dester_0584       CDS       T01427                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dester_0584
   01230 Biosynthesis of amino acids
    Dester_0584
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dester_0584
   00051 Fructose and mannose metabolism
    Dester_0584
   00562 Inositol phosphate metabolism
    Dester_0584
Enzymes [BR:dte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dester_0584
Exosome [BR:dte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dester_0584
  Exosomal proteins of bladder cancer cells
   Dester_0584
  Exosomal proteins of melanoma cells
   Dester_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(590489..591244)
Genome map
AA seq 251 aa AA seqDB search
MRRFLIAGNWKMHKTVSEAIELVRELKNLVKDVSDRDILICPPFTALYPVSKELEGSNIT
LGGQNMYFEEQGAFTGEISPLMLKSVGCSYVILGHSERRHIFGESDELINKKVLSSINHG
LIPILCVGELLEERENGKTKEVVEEQIREGLKNVNKDAEFVIAYEPVWAIGTGKTATPEL
AEEVHLFIREVLSDMFGNEKASSVKILYGGSVKPENAAGLLKMENIDGALVGGASLKAES
FAKIVKFDMEA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagacggtttctaatcgctggaaactggaaaatgcataaaacagtttctgaagctata
gagcttgttagagaattaaaaaatcttgttaaagatgttagtgatagagacattctaata
tgtccacctttcacagctctttatccagtttctaaagagcttgaaggttcaaatattact
cttggtggacaaaacatgtactttgaagaacagggagcttttacaggagaaatttctcct
ttaatgctcaaaagcgtaggatgttcttacgttattcttggacactctgaaagaagacac
atttttggtgaatcagacgaactgataaataaaaaagttctttcttccattaatcatggt
ctcattccaatactttgtgttggtgaacttttagaggaaagagaaaacggaaaaacaaaa
gaagttgtggaagaacagataagagaaggcctaaaaaatgttaacaaagacgctgaattt
gttatagcttacgaacctgtttgggcaattggaactggtaaaacggcaactcctgagtta
gcagaagaagttcatttgttcattcgcgaagtactttctgatatgtttggaaatgaaaag
gcaagttctgtgaaaattctttatggaggaagtgtaaagcctgaaaatgctgctggtctt
ttaaagatggaaaatattgatggagctctcgttggaggagcaagtcttaaagctgagagc
tttgcaaaaatagttaagtttgatatggaggcgtga

DBGET integrated database retrieval system