KEGG   Desulfurobacterium thermolithotrophum: Dester_0708Help
Entry
Dester_0708       CDS       T01427                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dester_0708
  Amino acid metabolism
   00340 Histidine metabolism
    Dester_0708
Enzymes [BR:dte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dester_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(726012..727337)
Genome map
AA seq 441 aa AA seqDB search
MKIVDLRTESWEKNSELLRIKNRGQGLESKYAQSVLEIIENVKKFGDSAVFSYAKKFDKI
ELTPENVRVTEEEIEEAFKKVEPEVLEAIKVAVTRVRKFHEHQKENSYFVTEPGMLLGQK
VTPLESAGIYVPGGKASYPSSVIMNAVPAKVAGVKKVVMITPAIGSFEVNPYSLVAAKLS
GVDEIYRVGGAHGVAAIAFGTESIPKVDKIVGPGNIYVALAKKFLFGTVDIDMVAGPSEI
LVIADESANPDWVAVDLLSQAEHDELAGSFLVTHGEEVAKAVIDALEDRLKKLKRREIAE
KSIENFGTAFITRDIYHSCEVANIVAPEHLEVATKEPFALLDHIKNAGAIFLGHYTCESL
GDYILGPNHVLPTGGSAKFFSPLGVYDFIKRSSILYVSKEGFKQISEHARNLAECEGLEA
HRLAVEVREAIKIPIKTEEKV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtagaccttagaacagaaagctgggaaaagaattcagagctcctaagaatc
aaaaacagggggcaaggacttgaaagcaaatatgcccagagtgttttagagataattgaa
aacgtgaaaaagtttggagatagtgcggtcttttcttatgcaaagaagtttgacaaaatt
gaactcactccagaaaacgttagggttactgaagaagaaattgaagaagcgtttaaaaag
gttgaacctgaagttcttgaagctataaaagttgctgttacaagagttagaaaattccat
gaacaccaaaaagaaaactcttactttgtaactgaacctggaatgcttcttggacaaaag
gttaccccccttgaaagtgctggaatttacgttcccggtggaaaggcttcttacccatcc
tctgtaataatgaatgcagttcctgcaaaggttgcaggagttaaaaaagttgtaatgatt
actccagccattggttcctttgaagttaatccttattcacttgtggctgcaaagctttct
ggagttgatgagatctacagggtcggtggagctcatggagttgctgcaatagcttttggt
actgagtctataccaaaggttgataaaatcgttggtcctggaaatatctacgttgcttta
gcaaagaagtttctttttggaacggttgatatagatatggttgcaggtccaagtgaaatt
cttgtaattgcagacgaatccgcaaatccagattgggttgctgttgaccttttatctcaa
gccgagcacgatgaactagccggttctttccttgttactcacggtgaagaagttgctaaa
gcagttattgatgctcttgaggatagacttaaaaaactaaaacgccgtgagatagctgaa
aaatctatagagaattttggaacagcttttattacaagagatatctatcattcctgcgaa
gtagcaaatatagtagcacctgagcaccttgaggttgcgacaaaagaaccttttgctctt
cttgatcacataaaaaacgctggtgctatcttcctcgggcattatacctgtgaatctttg
ggagactatatattaggacccaaccatgttctaccaacaggtggaagtgcaaagttcttt
tctcctctaggagtttacgatttcattaaacgttcctcaatcctttacgttagtaaagaa
ggatttaagcaaatttcagaacatgcaagaaaccttgctgagtgtgaaggattagaagcc
cacagacttgcagttgaggtaagagaagcaatcaaaatacctataaaaacagaagaaaag
gtttga

DBGET integrated database retrieval system