KEGG   Desulfurobacterium thermolithotrophum: Dester_0793Help
Entry
Dester_0793       CDS       T01427                                 

Definition
2-dehydropantoate 2-reductase (EC:1.1.1.169)
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Dester_0793
Enzymes [BR:dte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     Dester_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(799073..800023)
Genome map
AA seq 316 aa AA seqDB search
MRFAIFGTGGVGGFYGGMVARCGHEIVFIARGKKLKAMKEKGLTVKSFKHGEWTVKEDGK
RITFTDKPEEAGKVDVVFVCVKSYDTENVAPKLLPMLKEDTVVVSIQNGIENEEILAKYV
GENRVLGATAFVGAYVKEPGVVVHEAAGLLEIGEMSGQQSERVEKLVEELKKCGIEARAS
KDIRYTLWKKLVWNIAFNPYSVITGATVGEMLSMPESYEILKNLMEECYRVAEAHGVKLK
PKIMENYLKSSPDLMDYKTSMLLDFERGKPIELEGITGALIRKAEEKGIKIPYNRCVYGT
VKILLKKRDKKLMEKK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgcaatatttggaaccggcggagtcggaggattttacggcgggatggttgcc
cgctgtggtcatgagattgttttcattgcaagaggtaaaaagttaaaagcaatgaaagaa
aagggattaactgttaagagctttaagcacggtgagtggacagtcaaggaggatggaaag
agaattaccttcacagacaaaccagaagaggctggaaaagtcgatgttgtctttgtctgc
gtgaagtcctacgacactgaaaatgttgctccaaagttactcccaatgttaaaggaagat
actgttgttgtttccatccaaaacggaattgaaaatgaagagatactcgcgaaatacgtt
ggtgaaaatagagttttaggagctacagcgtttgtaggagcttacgttaaagaacctgga
gttgttgtccatgaagcagcaggtcttttagagattggggaaatgagtggacaacagtca
gaaagggttgaaaagcttgttgaagagcttaaaaaatgtggaattgaagcaagggcttca
aaagatatcagatacaccctctggaaaaagctggtctggaacattgcatttaacccttac
tcggtcataacgggagcaacagttggagaaatgctttctatgccggaaagttatgaaata
ctgaaaaacttgatggaggagtgctacagagttgctgaagcccacggcgttaagttaaaa
ccgaagatcatggaaaactacttaaaatcctctccagacttgatggactacaaaacttcg
atgcttttggattttgagagaggtaaaccaatagagctggaaggcataacaggagcctta
atcagaaaggctgaagagaaaggaattaagattccttacaatagatgtgtttacggtacc
gtcaagatcctcttaaagaagagagacaagaaattgatggaaaagaagtaa

DBGET integrated database retrieval system