KEGG   Desulfurobacterium thermolithotrophum: Dester_0802Help
Entry
Dester_0802       CDS       T01427                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Brite
Enzymes [BR:dte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dester_0802
Secretion system [BR:dte02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Dester_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808659..809327
Genome map
AA seq 222 aa AA seqDB search
MKSIIAIMIMIFSFYNSVAQECPSFSEAQAILNRTLKTPLTIKEIKNLKSFSACKISTHE
GETFFLSHDKRFLIEGILLKIPSFVLSFKDYGILKRNVLFSIGSGKEIIVLTNPLCKACQ
ENKQKLTKLAKKFRLSFVMVGFSKKEIAAASNAVCKKKNINDLFSLEENLDVCDTGKLKV
WTVSDILRRYGITGTPVFVFPDRKVAVGISDFERMLTKFTLH
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattatagccataatgataatgattttctcgttttataactcagtagcacag
gaatgtcccagtttttcagaagcacaggctatacttaatagaacactaaagacaccttta
actattaaagaaattaaaaatctgaaaagcttttccgcttgcaaaatttctacacatgaa
ggagaaaccttctttttatcccatgataaaaggtttctaatagaaggaattttgttaaag
attccttcttttgtcctttcttttaaagactatggcattttaaaaaggaacgttcttttt
tctattggaagtggtaaagagataattgtccttactaatcctttatgtaaagcttgccaa
gaaaataagcaaaaattaactaaattggcaaaaaaattccgtttaagctttgtaatggtc
ggttttagcaaaaaggaaatagccgctgcttctaacgcggtttgtaagaaaaaaaatatt
aatgatctctttagtttagaagaaaatctagatgtatgtgatacaggaaaactaaaggtt
tggacagtttcagatatcttgagaagatatggaataacaggaactcctgtttttgttttt
ccagatagaaaagtagcagttggtattagtgattttgaaagaatgctaaccaagttcaca
cttcactaa

DBGET integrated database retrieval system