KEGG   Desulfurobacterium thermolithotrophum: Dester_0904Help
Entry
Dester_0904       CDS       T01427                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dte00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dester_0904
Enzymes [BR:dte01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Dester_0904
Amino acid related enzymes [BR:dte01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Dester_0904
Transfer RNA biogenesis [BR:dte03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Dester_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(908988..910454)
Genome map
AA seq 488 aa AA seqDB search
MSIRVRFAPSPTGFMHVGNARTALFNYLFAKHNDGKLILRIEDTDLERHSEEAVNVIYEA
LKWMGISWDEGPNIGGDYGPYRQSERLDIYKRYIEELKNKGLVYECFCTPEELDAMRKEQ
LERGEPPRYTGKCRNLTEKEKERFKAEGRKPVLRFKVPEDRVIKFKDLIKGEIEIHSRQL
GGDFVLVRSNGMPVYNFVVVIDDALMKISHVIRGEDHISNTPKQILLYEALGFSIPQFAH
LPMILGTDRSKLSKRHGSTSVKEFRDKGYLSESFTNFLALLGWYPKDGKEILSMEELIER
FDIKDVNSAPAVFDTTKLNWMNQVYIRAYPIDKLTDFIIPYLEKVGFEVSKFDRSWLEKV
VEVTRDYLTVLSEAPIYMETFLKDDFEIEEEAKKFVLENEVRLKVVETFYVKVENLDEEL
SSEKFKQIVKEVGKELKAKGKNLFMPVRIALTGKMKGVELDILISLLGKERVLKRISNSL
SQLANKSN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctataagagttcgttttgctccaagtcccacaggttttatgcacgtaggaaatgca
agaacagctctttttaactatctctttgcaaagcataatgatggaaagctcatattaaga
atagaagatacagatcttgagagacacagcgaagaagcagttaatgtaatttatgaagct
cttaagtggatgggaataagctgggatgaaggtccaaacatcggtggtgattatggtcct
tatagacagtctgaaagattagatatctacaaaaggtacatagaggagttaaaaaataaa
ggacttgtttacgaatgtttctgtacacctgaagaattggatgcaatgagaaaagaacag
ctggaaagaggagaacctcctcgttatactggaaagtgtagaaatcttacggaaaaagaa
aaagaaagatttaaagctgaaggtagaaaaccggtacttagatttaaagttccagaagat
agagttataaagtttaaagaccttataaaaggagaaatagaaattcatagtagacagcta
ggtggtgactttgtcttggttcgttcaaatggaatgcctgtttataactttgttgtagtt
attgatgatgcacttatgaaaatttctcacgtcataagaggagaagatcatatatcaaat
actcctaagcaaattcttctttatgaagctcttggattttctattccgcagtttgctcat
cttccaatgattcttggaacagatagaagtaagctttcaaagcgccacggttcaaccagc
gttaaagaattcagagataaaggatacctttctgaatcctttacaaatttcttagcactt
cttggctggtatccaaaagatggaaaagagattctctccatggaagagctaattgaaagg
tttgatataaaggatgtaaacagtgcacctgctgtttttgatacaactaaacttaattgg
atgaatcaggtttacattagagcctatccgattgataaactaacagatttcattattcct
tatcttgaaaaagttggttttgaagttagtaaatttgatagaagctggcttgaaaaagtt
gtagaggtcacaagagattatcttactgtactttcagaggctcctatttatatggaaact
ttcctaaaagatgactttgaaatagaagaagaagctaaaaaatttgtattagaaaatgaa
gtaagattaaaggtagttgaaactttctatgttaaggtagaaaaccttgatgaggagtta
tcttcagaaaagtttaagcagatagtaaaagaagtagggaaagagttgaaagcaaaaggt
aaaaatctttttatgcctgtgagaattgctcttactggtaagatgaaaggggttgaatta
gatatcttaatttcacttcttggaaaagaaagagttttaaaaagaattagtaatagtctt
agccagttagcaaataaatctaactaa

DBGET integrated database retrieval system