KEGG   Desulfurobacterium thermolithotrophum: Dester_0940Help
Entry
Dester_0940       CDS       T01427                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dester_0940
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dester_0940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dester_0940
Enzymes [BR:dte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dester_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(945353..946141)
Genome map
AA seq 262 aa AA seqDB search
MERIKNCFEKLLLKGEKPLIVYATACDPSCSESVEIFKLILKYADMVEIGMPFSDPLADG
PTIQKAHERALSSGANTQKVFELVKKIREFESEKPIILMGYYNPIFVYGEDKFIRDAFNA
GVDGFIVPDLPPEEGEDFARKVKSMKLSPIFLAAPTSTDERVRKIGEVTGEFIYYVSVTG
ITGEREELAYKEIGKDIERIKRITGKKTVVGFGISRGKHIREMYNTPDGFVVGSAVVKRI
EKGNFEELESLLRELKEATKPC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaataaaaaactgttttgagaagcttcttttaaaaggagaaaaacctttaata
gtttatgctacagcttgtgatcctagttgttctgaatctgtagagatctttaaattaatc
ttgaaatatgctgatatggtagagataggaatgcccttttctgatcctttggccgatggt
cctactattcaaaaagctcatgaaagagctctatcttcaggagcaaacactcaaaaggtt
tttgaacttgttaagaaaattagagaatttgagagtgaaaagcctataattttaatggga
tactataatccaatattcgtttatggcgaagataagtttattagagatgcatttaacgca
ggcgtggatggctttatagttccagaccttcctcctgaagaaggagaggattttgctaga
aaagttaagtctatgaagttatctcccattttcttagcagctccaacaagtaccgatgaa
agggtgagaaaaataggagaagttacaggtgagtttatttattatgtttctgttacagga
attacaggagaaagagaagaacttgcttataaagaaataggaaaagatattgaaagaatt
aaaagaattactggaaagaaaacggtagttggttttggaatttcaagaggaaaacatata
agagaaatgtataatactcctgatggatttgtagttggtagtgcggtagtcaaaagaata
gaaaaaggaaattttgaagaattagaatctcttttgagagagctcaaagaagcaactaaa
ccttgttga

DBGET integrated database retrieval system