KEGG   Desulfurobacterium thermolithotrophum: Dester_0940Help
Entry
Dester_0940       CDS       T01427                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00260  Glycine, serine and threonine metabolism
dte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dte01100  Metabolic pathways
dte01110  Biosynthesis of secondary metabolites
dte01130  Biosynthesis of antibiotics
dte01230  Biosynthesis of amino acids
Module
dte_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dester_0940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dester_0940
Enzymes [BR:dte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dester_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB
Motif
Other DBs
NCBI-ProteinID: ADY73579
UniProt: F0S407
Position
complement(945353..946141)
Genome map
AA seq 262 aa AA seqDB search
MERIKNCFEKLLLKGEKPLIVYATACDPSCSESVEIFKLILKYADMVEIGMPFSDPLADG
PTIQKAHERALSSGANTQKVFELVKKIREFESEKPIILMGYYNPIFVYGEDKFIRDAFNA
GVDGFIVPDLPPEEGEDFARKVKSMKLSPIFLAAPTSTDERVRKIGEVTGEFIYYVSVTG
ITGEREELAYKEIGKDIERIKRITGKKTVVGFGISRGKHIREMYNTPDGFVVGSAVVKRI
EKGNFEELESLLRELKEATKPC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaataaaaaactgttttgagaagcttcttttaaaaggagaaaaacctttaata
gtttatgctacagcttgtgatcctagttgttctgaatctgtagagatctttaaattaatc
ttgaaatatgctgatatggtagagataggaatgcccttttctgatcctttggccgatggt
cctactattcaaaaagctcatgaaagagctctatcttcaggagcaaacactcaaaaggtt
tttgaacttgttaagaaaattagagaatttgagagtgaaaagcctataattttaatggga
tactataatccaatattcgtttatggcgaagataagtttattagagatgcatttaacgca
ggcgtggatggctttatagttccagaccttcctcctgaagaaggagaggattttgctaga
aaagttaagtctatgaagttatctcccattttcttagcagctccaacaagtaccgatgaa
agggtgagaaaaataggagaagttacaggtgagtttatttattatgtttctgttacagga
attacaggagaaagagaagaacttgcttataaagaaataggaaaagatattgaaagaatt
aaaagaattactggaaagaaaacggtagttggttttggaatttcaagaggaaaacatata
agagaaatgtataatactcctgatggatttgtagttggtagtgcggtagtcaaaagaata
gaaaaaggaaattttgaagaattagaatctcttttgagagagctcaaagaagcaactaaa
ccttgttga

DBGET integrated database retrieval system