KEGG   Desulfurobacterium thermolithotrophum: Dester_0940Help
Entry
Dester_0940       CDS       T01427                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dester_0940
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dester_0940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dester_0940
Enzymes [BR:dte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dester_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(945353..946141)
Genome map
AA seq 262 aa AA seqDB search
MERIKNCFEKLLLKGEKPLIVYATACDPSCSESVEIFKLILKYADMVEIGMPFSDPLADG
PTIQKAHERALSSGANTQKVFELVKKIREFESEKPIILMGYYNPIFVYGEDKFIRDAFNA
GVDGFIVPDLPPEEGEDFARKVKSMKLSPIFLAAPTSTDERVRKIGEVTGEFIYYVSVTG
ITGEREELAYKEIGKDIERIKRITGKKTVVGFGISRGKHIREMYNTPDGFVVGSAVVKRI
EKGNFEELESLLRELKEATKPC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaataaaaaactgttttgagaagcttcttttaaaaggagaaaaacctttaata
gtttatgctacagcttgtgatcctagttgttctgaatctgtagagatctttaaattaatc
ttgaaatatgctgatatggtagagataggaatgcccttttctgatcctttggccgatggt
cctactattcaaaaagctcatgaaagagctctatcttcaggagcaaacactcaaaaggtt
tttgaacttgttaagaaaattagagaatttgagagtgaaaagcctataattttaatggga
tactataatccaatattcgtttatggcgaagataagtttattagagatgcatttaacgca
ggcgtggatggctttatagttccagaccttcctcctgaagaaggagaggattttgctaga
aaagttaagtctatgaagttatctcccattttcttagcagctccaacaagtaccgatgaa
agggtgagaaaaataggagaagttacaggtgagtttatttattatgtttctgttacagga
attacaggagaaagagaagaacttgcttataaagaaataggaaaagatattgaaagaatt
aaaagaattactggaaagaaaacggtagttggttttggaatttcaagaggaaaacatata
agagaaatgtataatactcctgatggatttgtagttggtagtgcggtagtcaaaagaata
gaaaaaggaaattttgaagaattagaatctcttttgagagagctcaaagaagcaactaaa
ccttgttga

DBGET integrated database retrieval system