KEGG   Desulfurobacterium thermolithotrophum: Dester_1040Help
Entry
Dester_1040       CDS       T01427                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dester_1040
Enzymes [BR:dte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dester_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1038120..1038680
Genome map
AA seq 186 aa AA seqDB search
MAFDRERIEKAVREILIAIGEDPDREGLKDTPKRVAKMYEEILAGYNDSAENHLVLFTEK
YDEMIIVRDIPIYSLCEHHMLPFFGKAHVAYIPGEDKVTGLSKLARIVDVYAKRLQLQER
MTEQIADAIMEKLGAKGVMVVVEAQHLCMIMRGVKKPGSYTVTSAVKGAMRKEPTRMEAL
FLIKGR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttggcttttgatagagaaagaatagaaaaagccgttagagaaattcttattgctatagga
gaagatccagatagagaaggactaaaggatactccaaaaagagtagcaaagatgtatgaa
gaaattcttgctggttataacgactctgcagaaaatcacttagttcttttcaccgaaaaa
tatgatgagatgataattgttagagacattcctatctattctttgtgtgagcatcatatg
cttccattttttggaaaagcacatgtagcttacattccaggagaggataaggttacagga
ctttccaagttagctagaattgttgatgtttatgctaaaaggcttcaacttcaagaaaga
atgaccgagcaaatagcagatgcaataatggagaaattaggtgcaaaaggtgtaatggtt
gttgttgaagcacagcatctttgtatgataatgagaggagttaagaaacctggctcttat
acggtaacaagtgctgtcaagggagcaatgagaaaagaacccacaagaatggaggctctt
tttcttataaaggggaggtaa

DBGET integrated database retrieval system