KEGG   Desulfurobacterium thermolithotrophum: Dester_1040Help
Entry
Dester_1040       CDS       T01427                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00790  Folate biosynthesis
dte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dester_1040
Enzymes [BR:dte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dester_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF FolB
Motif
Other DBs
NCBI-ProteinID: ADY73678
UniProt: F0RZZ7
Position
1038120..1038680
Genome map
AA seq 186 aa AA seqDB search
MAFDRERIEKAVREILIAIGEDPDREGLKDTPKRVAKMYEEILAGYNDSAENHLVLFTEK
YDEMIIVRDIPIYSLCEHHMLPFFGKAHVAYIPGEDKVTGLSKLARIVDVYAKRLQLQER
MTEQIADAIMEKLGAKGVMVVVEAQHLCMIMRGVKKPGSYTVTSAVKGAMRKEPTRMEAL
FLIKGR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttggcttttgatagagaaagaatagaaaaagccgttagagaaattcttattgctatagga
gaagatccagatagagaaggactaaaggatactccaaaaagagtagcaaagatgtatgaa
gaaattcttgctggttataacgactctgcagaaaatcacttagttcttttcaccgaaaaa
tatgatgagatgataattgttagagacattcctatctattctttgtgtgagcatcatatg
cttccattttttggaaaagcacatgtagcttacattccaggagaggataaggttacagga
ctttccaagttagctagaattgttgatgtttatgctaaaaggcttcaacttcaagaaaga
atgaccgagcaaatagcagatgcaataatggagaaattaggtgcaaaaggtgtaatggtt
gttgttgaagcacagcatctttgtatgataatgagaggagttaagaaacctggctcttat
acggtaacaagtgctgtcaagggagcaatgagaaaagaacccacaagaatggaggctctt
tttcttataaaggggaggtaa

DBGET integrated database retrieval system