KEGG   Desulfurobacterium thermolithotrophum: Dester_1070Help
Entry
Dester_1070       CDS       T01427                                 

Definition
pyruvate synthase (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:dte01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dte00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dte00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dte00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dte00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dte00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:dte00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:dte00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dte00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1062788..1063765)
Genome map
AA seq 325 aa AA seqDB search
MAQIKTAEIKVPPLKKLTNYPEKLVPGHRLCAGCGASIIIRQMYMVASALGYELIIANAT
GCVEVCTTIYPYNAWKSPWIHNAFENAAATISGAEAAYKALKRKGKLPTDKKVKFVALGG
DGGTYDIGFQSLSGALERGHDFIYVCYDNEAYMNTGIQRSSATPKYANTTTQPVGSESFG
KPQTKKWMPEVVAAHGIPYVAQVAPSHWKDFMEKFKKALLTEGPSFINAFSVCPRGWRSK
EEEGILVTKLAVETNYWPLFEVENGKWRITYRPKNPKPLEEFLKLQGRFKHLFKPENKHL
IDELQAEVDRRWERLNRMENLTREE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaattaaaactgctgaaattaaagttccgcctttgaagaaactaacaaactat
cctgaaaagcttgttcctggccatagactttgtgctggatgtggagcctcaattatcata
agacagatgtacatggtagcaagtgctcttggatatgaattaatcatagctaatgcaact
ggttgcgtggaagtttgtactactatttatccatacaatgcatggaagtctccttggatt
cataacgcctttgagaacgctgctgctacaatctctggggctgaagcggcttataaagct
cttaaaagaaagggaaaactacctacagataagaaggtaaagtttgttgctcttggtgga
gatggtggaacttacgatattggattccagtctctttctggagctcttgaaaggggacat
gattttatttacgtatgttatgataacgaagcttacatgaacacaggtattcaacgttcc
agtgctactccaaaatatgcaaatacaactacacaaccagtaggtagcgaaagttttgga
aaacctcagactaagaaatggatgcctgaagttgtagcagctcacggtataccatacgtt
gcgcaagttgctccttctcattggaaagatttcatggagaaatttaaaaaagctctctta
acagaaggtccttcttttataaatgcgttttctgtttgcccaagaggttggcgttcaaag
gaagaagaaggtatacttgtaactaagcttgcagtagaaacaaactactggccgctgttt
gaagttgaaaatggtaagtggagaattacatacagaccaaagaatcctaagccactagaa
gaatttttaaagcttcaaggaagatttaagcatttattcaaacctgagaacaagcatctc
atagatgaactccaagcagaagttgacagaagatgggagagacttaaccgtatggaaaat
cttactagggaagagtaa

DBGET integrated database retrieval system