KEGG   Desulfurobacterium thermolithotrophum: Dester_1071Help
Entry
Dester_1071       CDS       T01427                                 

Definition
pyruvate synthase (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dester_1071
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dester_1071
   00020 Citrate cycle (TCA cycle)
    Dester_1071
   00620 Pyruvate metabolism
    Dester_1071
   00640 Propanoate metabolism
    Dester_1071
   00650 Butanoate metabolism
    Dester_1071
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dester_1071
   00680 Methane metabolism
    Dester_1071
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dester_1071
Enzymes [BR:dte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Dester_1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1063777..1064985)
Genome map
AA seq 402 aa AA seqDB search
MRPELIKEVTYVPYSGNMAAAEAMRQINPDVVAAYPITPQTELMQCFADFVANGLVDSEY
IPVESEHSAMSACVGAAAAGSRAMTATAGPGLAYMWEVLGIASGMRLPIVMTVVNRALSA
PINIHGDQSDMMGARDQGWIMLFSENAEEQYDNLIQVIRIAEDERTRLPVMIGMDGFVIS
HAIERVRLLPDKAVEEFVGELKPMYSLLDVDNPVAHGAVAMTDSYMEFKRQQREAMMNAY
KVIREVGKAFEEAFGKKYEHIEAYKTEDADYILVVTGSAAGTAKYVVDKLREEKGIKVGI
IKIRTFRPFPYYDVMDAIEASNCKAIGILDRAETFGGASGPLFEEVATAQHLRRKYYPMT
GFIYGLGGRDTNVHHIEEAIDKVMKLAAGEEVPLVNYLNLKE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgagcttataaaggaagtaacttacgttccgtactccggaaacatggcagca
gctgaagctatgagacaaattaatcctgacgttgttgctgcttatccaattactccacaa
actgaactaatgcaatgttttgcagattttgtggctaatggccttgttgacagtgagtac
attcctgtagaaagtgaacactctgcaatgtctgcttgtgttggggctgcagctgccgga
agtagagcaatgactgcgacagctggtcctggtcttgcttatatgtgggaagttcttggt
atcgcttctggaatgagacttccaatagttatgacagttgtaaatagagctctctctgct
cctattaacattcacggtgatcagtcagatatgatgggagcaagagatcaaggctggatt
atgctcttttccgaaaatgctgaagagcagtatgacaacttaattcaggtcataaggata
gctgaagacgaaagaacaaggcttcccgtgatgattggaatggacggatttgtaatctcc
catgctattgaaagagtaaggcttcttcctgataaggcagtagaagagtttgtgggtgaa
ctaaaacctatgtattcgcttcttgatgttgacaaccctgtagctcacggtgctgttgct
atgacggattcttacatggagttcaaaaggcagcagagagaagctatgatgaatgcctat
aaagtaataagagaagttggaaaagcttttgaagaggcttttggaaagaaatatgagcac
attgaagcttacaaaacagaagatgcagattacatccttgttgtaaccggttctgcagct
ggaacagctaaatatgttgttgataagttaagagaagaaaagggtataaaggtcggtata
atcaaaataagaacatttagacctttcccttactacgatgtaatggatgcaatagaagct
tcaaactgtaaagcaataggaatacttgatagagctgaaacttttggaggtgcttcagga
ccattatttgaagaagtagcaacggcacagcacttaagacgtaagtactatccaatgaca
ggtttcatttatggtcttggtggaagggatacaaatgttcaccatattgaagaggctatt
gataaagtaatgaagcttgctgcaggagaggaagtacctctagttaattaccttaaccta
aaagagtaa

DBGET integrated database retrieval system