KEGG   Desulfurobacterium thermolithotrophum: Dester_1072Help
Entry
Dester_1072       CDS       T01427                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00010  Glycolysis / Gluconeogenesis
dte00020  Citrate cycle (TCA cycle)
dte00620  Pyruvate metabolism
dte00633  Nitrotoluene degradation
dte00640  Propanoate metabolism
dte00650  Butanoate metabolism
dte00680  Methane metabolism
dte00720  Carbon fixation pathways in prokaryotes
dte01100  Metabolic pathways
dte01120  Microbial metabolism in diverse environments
dte01130  Biosynthesis of antibiotics
dte01200  Carbon metabolism
Module
dte_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
dte_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dester_1072
   00020 Citrate cycle (TCA cycle)
    Dester_1072
   00620 Pyruvate metabolism
    Dester_1072
   00640 Propanoate metabolism
    Dester_1072
   00650 Butanoate metabolism
    Dester_1072
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dester_1072
   00680 Methane metabolism
    Dester_1072
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dester_1072
Enzymes [BR:dte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Dester_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_16 Fer4_7 Fer4_10 Fer4_9 Fer4_13 Fer4_4 Fer4_15 Fer4_17 Fer4_8 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ADY73709
UniProt: F0S028
Position
complement(1064988..1065281)
Genome map
AA seq 97 aa AA seqDB search
MIKGWKELPIGGVIIEPGSSEKYDTGEWRAWRPVFDSSKCVHCMMCWIFCPDSSILVKEE
KMVGIDYDHCKGCGICAHECPTNALEMKPEYLFREED
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgattaagggttggaaagaattacctataggtggtgtaataattgaacctggttcaagt
gaaaagtatgatacaggtgagtggagagcttggagaccagtatttgatagtagtaaatgt
gttcattgtatgatgtgttggatattctgtccggattccagtattttagtgaaagaagaa
aagatggttggtattgactacgatcactgtaaaggttgcggtatttgtgctcatgaatgt
ccaacaaatgctcttgaaatgaaacctgaatacttgttccgtgaggaggactaa

DBGET integrated database retrieval system