KEGG   Desulfurobacterium thermolithotrophum: Dester_1074Help
Entry
Dester_1074       CDS       T01427                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dester_1074
DNA repair and recombination proteins [BR:dte03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dester_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1065844..1066449)
Genome map
AA seq 201 aa AA seqDB search
MIYPDNLELLIRFLSETPGISERAAERAVLSLSRLDEDEKRMITNALRELERIKPCVECG
LPTEEDLCVVCRDPEREQTVICVVEQPRDAISIEKLGEYKGLYHVLGGVISPLEDISPED
LRIESLFKRIKEKNIKTVIIALNPTVEGEATSKFLIDRLEKMNVEIYRISYGIPYGGTID
MADELTLKKAFEDKKLIAGGK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgatatatccagataaccttgagctccttataagatttctttcggaaactcctggaatt
agcgaaagagctgcagaaagggctgtattgtctctttcacggcttgatgaagacgaaaaa
cgaatgataactaatgctttaagggagcttgaaaggataaagccgtgtgttgagtgcggt
ttacctacagaagaagatctctgtgtagtatgtagagatccagaaagagaacagacagtt
atctgtgttgttgagcaacctagagatgcaatttcgatagaaaagcttggtgagtataaa
ggtctttaccatgttttaggtggtgttatatctcctttggaagatatttcgccggaagat
ttaaggatagaaagtctctttaaaagaattaaagaaaagaatataaaaactgtcattata
gctcttaatcctacagtcgaaggcgaagcaacttcaaagtttttaatagatagacttgag
aagatgaatgtagagatttacagaataagctacggtattccttacggtggaacgatagat
atggcagacgagttaactttaaaaaaagcttttgaggacaagaaactcatagctggagga
aagtaa

DBGET integrated database retrieval system