KEGG   Desulfurobacterium thermolithotrophum: Dester_1121Help
Entry
Dester_1121       CDS       T01427                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
dte  Desulfurobacterium thermolithotrophum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108564..1109649
Genome map
AA seq 361 aa AA seqDB search
MEDRADNIECKLLKKVRQERKFSKEELQLITNIAKEELKFLARNNIPLIPENYVLWFDIF
CYLTENNLKLSDLEIIGLFKEKYPSKEKIENVLVEVETEEKDLVKKVAEEINQEIEEIIE
ALKEHQESLKNKEASVKEIRENTEDQIVRGILNKVLDELKTIREQNDLLRNKLEESNQQI
KKLRKELEESKKEANIDFLTRVANRASFDRAISDMVKDFYERNYPFALLMIDIDNFKQIN
DTYGHQAGDHVLRELARTIKEQLRARDVVARYGGEEFAILIPGVTFAQAVRIAERIRKNI
EKHLFRYKDTVIPVTASIGVAVMRNGLDETGIIEKADQALYLAKRNGKNQIKTDLDVELE
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaagatagagcagacaatattgaatgtaagcttcttaagaaagttcgtcaagagaga
aaattctcaaaggaagaactccagttaataacaaatattgcaaaagaagaactcaaattt
ttagcccgtaataatattcctttaataccagaaaactatgttctttggtttgatatattc
tgttacttaacggaaaataatttgaaactatcagatcttgaaatcataggactctttaag
gaaaagtatccttcaaaagaaaaaatagaaaatgttttggtggaagttgaaacagaagaa
aaagatttagtaaaaaaagttgctgaagagataaaccaagaaatagaggaaattatcgaa
gcactgaaagaacatcaagaatctttaaagaataaagaagcttctgtaaaagaaattaga
gaaaatactgaagatcaaatagttagaggaattttaaataaggttttagatgaacttaaa
actattagagagcaaaatgatcttttaagaaacaagcttgaagaatcaaatcaacaaata
aagaaattaagaaaagagttagaagaatcaaaaaaagaagccaatattgatttcttaaca
cgagtagctaacagagcaagttttgatagagcaataagcgatatggttaaagatttttat
gaaaggaattatccctttgctttgttaatgattgacatagataactttaagcagataaat
gatacatatggacatcaagctggagatcatgttttgagagaacttgcaagaacaataaag
gaacaattaagagctagagatgttgttgctaggtatggaggtgaagaatttgcaattctt
attccaggagttacttttgctcaagctgttagaattgcagaaagaataaggaagaatata
gagaaacatttatttaggtacaaggatacggttattcctgtaactgcaagtattggagtt
gcagttatgaggaatggacttgacgagacaggaattatagaaaaagcggatcaagcttta
tatttagctaaaagaaacggaaaaaaccaaataaaaacagatcttgatgtagagttagaa
gaatga

DBGET integrated database retrieval system