KEGG   Desulfurobacterium thermolithotrophum: Dester_1135Help
Entry
Dester_1135       CDS       T01427                                 

Definition
ATP-grasp domain-containing protein
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dester_1135
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dester_1135
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dester_1135
Enzymes [BR:dte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Dester_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1122974..1124275)
Genome map
AA seq 433 aa AA seqDB search
MAQRGIREYDGKRILAEHWNEYFAPEFEYDFKSVLVTPQTDLDKLPEEYPWLRELPLVAK
PDMLFGKRGKLGLILFKKEKPCDVDYEAAKEWIKKKMEEDVEIKGKKGKLTHFLIEPCVP
HAQEDEYYVAMTLGQDGDHIFMSAFGGIDVEENWDKVKEVVIPVLATDEEAEKLIEENVP
EEIKDKEKYADFVKRLYKFFKDMHFAYLEINPLVMVGNKIYPLDFVGRLDDTAQFLVGRK
WGEIEFPAGFGGELTPEEKYIKEMDEKSGASLKLTILNPEGRIWTLVAGGGASVVYADTV
ADLGYVNELANYGEYSGNPSRAETREYVKTVLDLMTRKKDPQGRPKILIIGGAIANFTDV
AKTFDGIIDAFKEYADKMKEVGVKIYVRRGGPNYEVGLARIKKAAEELGLPIEVYGPETH
ITAIVKKALTENP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagagggattagagaatacgatggtaaaagaatccttgcagagcactggaac
gagtattttgctccagagtttgagtacgactttaaatcagttcttgtaacgccacaaaca
gacttagataaacttccagaagagtatccatggcttagagaattaccacttgttgcaaaa
cctgacatgctctttggtaaaaggggtaagcttggacttatcctctttaagaaagaaaag
ccttgtgatgttgattacgaagctgcaaaagagtggattaagaagaaaatggaagaagat
gtagagataaaaggaaagaaaggtaaacttactcacttcctcattgaaccatgtgttcca
cacgctcaggaagatgaatactacgttgctatgacacttggtcaggatggtgaccacatc
ttcatgtctgcgtttggtggaattgacgttgaagaaaactgggacaaggtaaaagaagtt
gttattcctgttctcgcaacagatgaagaagctgaaaagcttattgaagaaaacgtacct
gaagaaataaaggataaagagaagtatgctgactttgtaaagagactctacaagttcttt
aaagacatgcactttgcataccttgaaatcaaccctcttgttatggttggaaataaaatc
tacccacttgactttgtaggaagacttgacgatacagcacagttcttggttggtagaaag
tggggtgagatagagtttccagcaggatttggtggagagcttacaccagaagagaagtac
attaaagaaatggacgaaaagtccggtgcttcacttaaactcacaattcttaacccagaa
ggtagaatctggactctcgttgctggtggtggagcatctgtagtttacgcagacactgtt
gcagaccttggatacgttaatgaacttgcaaactacggtgaatactccggtaacccatca
agggctgaaacaagagagtacgttaagactgttctcgaccttatgacaagaaagaaagat
cctcaaggaagaccaaagatcctcatcatcggtggtgctattgctaacttcacagacgtt
gctaagacattcgacggaatcattgatgctttcaaagagtatgctgataagatgaaagaa
gttggagtgaaaatctacgtacgtcgtggaggacctaactacgaagttggtcttgcaaga
atcaaaaaagctgcagaagagcttggtcttccaatagaggtttacggtccagaaactcac
attacagcaattgttaaaaaagctctcacagagaatccttaa

DBGET integrated database retrieval system