KEGG   Desulfurobacterium thermolithotrophum: Dester_1383Help
Entry
Dester_1383       CDS       T01427                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dte  Desulfurobacterium thermolithotrophum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1375248..1376153)
Genome map
AA seq 301 aa AA seqDB search
MRLLTAFLALSFFCSCSAVQEKELKSEKKEIQKEEATIKAILKPLAAKGIEVKEVKELKD
SPVEGLRTFEVTLIDKKNSRVIKKYLWLSKDNRYLVLDLFELKQEGKNVVLSQVKPKESV
IPLKQDLSWLKKIEEELNKENIPHILGNGKNKIYVVWDVYCPFCFNHFKKVAGEKLKELD
LQIHLIPLPVHGEKSIKGFVYFTQMARKEGMKEAMTDMFSKGEGNFLKFDNVFSKEVNEK
YSKIPKKEREELEKFYKKLQKELLSYNIHATPTIIYIPPTEKDKGYVFVGFKPFEEVLKM
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagacttcttacagcttttcttgctttgtcttttttctgttcgtgttctgctgttcag
gaaaaagagttaaaaagcgaaaaaaaagaaatacagaaagaagaagcaactattaaagca
attttaaaacctcttgctgctaaaggaatagaagtaaaggaagtaaaagaattaaaagat
tctccagttgaaggtctaagaactttcgaagttacgttgattgataaaaaaaatagcaga
gtaattaaaaaatacttatggctatcaaaagataatagatatcttgttcttgatctattt
gaattaaaacaggaaggaaaaaatgtcgttttaagtcaagttaaacctaaagaaagtgta
atcccgttaaagcaagatctttcctggcttaagaagatagaagaagaactaaataaagaa
aatattcctcatattttaggaaatggaaagaataagatttatgtagtttgggacgtttat
tgtcctttctgttttaaccactttaagaaggtagctggagaaaaactaaaggagcttgat
cttcagattcatttaattcctcttcctgttcatggagaaaagtctataaaaggttttgtt
tactttacccaaatggctaggaaagagggaatgaaagaggctatgactgatatgttttct
aagggagagggaaactttttaaaatttgataatgttttttctaaagaagtaaatgagaaa
tacagcaagattcctaagaaagaaagagaagaacttgaaaagttttataaaaaacttcaa
aaagaacttctttcttacaatattcatgcgactccaactattatctacattccacctaca
gaaaaagataaaggttatgtttttgtaggttttaaaccatttgaagaagttctaaagatg
aagtga

DBGET integrated database retrieval system