KEGG   Desulfurobacterium thermolithotrophum: Dester_1404Help
Entry
Dester_1404       CDS       T01427                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00040  Pentose and glucuronate interconversions
dte00052  Galactose metabolism
dte00500  Starch and sucrose metabolism
dte00520  Amino sugar and nucleotide sugar metabolism
dte01100  Metabolic pathways
dte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dte00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dester_1404
   00052 Galactose metabolism
    Dester_1404
   00500 Starch and sucrose metabolism
    Dester_1404
   00520 Amino sugar and nucleotide sugar metabolism
    Dester_1404
Enzymes [BR:dte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dester_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADY74035
UniProt: F0S1N2
Position
1398340..1399218
Genome map
AA seq 292 aa AA seqDB search
MIKKAVIPVAGLGTRFLPATKAQPKEMLPIVDKPVIQYIVEEAVRAGIKQIVFVTGKHKR
AIEDHFDTNFELEYTLEKKGKEELLKLVREVTNLAEIVYIRQKEPLGLGHAILTAEPAIG
NEPFAVLLGDDIMISNPPAIKQLMNVFDKYRCTVLGVQEVSEKDVSKYGIIGGKEIETSV
FKVDTLVEKPSLEEAPSNLAITGRYILTPAIFDALKKTPPGKGGEIQLTDGIERLGMKEA
LYAKVMEGERYDTGSKLGFLIATVDFALRRKDLREPFLEFLREKIKEEKDNG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaaaggctgttatacctgttgcaggtcttggtacaagattcttgccagctaca
aaggctcagccaaaagaaatgcttccaattgttgataaacctgtaatacagtacatagtt
gaggaagctgttagagctggtattaaacagatagtttttgtaacaggaaaacataaaaga
gctatagaagaccactttgatacaaattttgaattagaatatacattggagaaaaaagga
aaagaagagctcttaaaacttgtaagggaagtaacaaatcttgcagaaattgtttatata
agacagaaagaacccttaggacttggacatgccatattaacagcagaaccagctattggt
aacgaaccatttgcggttttattaggtgatgacataatgatttcaaatcctccagctata
aaacagttgatgaatgtttttgataagtataggtgtacagtcttaggagttcaagaagtt
tcagaaaaggatgttagtaagtacggtataatcggtggtaaggaaatagaaacaagtgta
tttaaagtagatactcttgtggaaaaaccttctttagaggaggctccttcaaaccttgca
attactggaagatacatcttaacaccggcaatttttgatgcattaaagaaaacaccacct
ggcaaaggcggcgagatacaacttacagatggtatcgagagacttgggatgaaagaagcg
ctatatgctaaagtaatggaaggagaaaggtatgatacaggaagcaaattaggatttttg
attgctactgtcgattttgctcttagaagaaaagatttaagagaaccatttttggaattt
ttaagagaaaaaattaaagaggagaaggataatggctga

DBGET integrated database retrieval system