KEGG   Dictyoglomus thermophilum: DICTH_0069Help
Entry
DICTH_0069        CDS       T00774                                 

Definition
alcohol dehydrogenase II (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DICTH_0069
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_0069
  Lipid metabolism
   00071 Fatty acid degradation
    DICTH_0069
  Amino acid metabolism
   00350 Tyrosine metabolism
    DICTH_0069
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DICTH_0069
   00626 Naphthalene degradation
    DICTH_0069
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DICTH_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81674..82864
Genome map
AA seq 396 aa AA seqDB search
MKENLNFSYFIPTKIWFGPGSLEKLREEKLPGRKALIVISAGGSMKRLGYLDRLTDILKS
KGVEYVVFDKILPNPIKKHVMEGAQIAREEKCDFVIGLGGGSSIDSAKSIALMAKNDGDY
WDYIVGGTGKGKKPEKGALPIVAITTTAGTGTEADPWTVITNEETNEKIGYGNEYTFPTL
SIVDPELMLSVPPHLTAYQGFDAFFHAVEGYIANIATPVSDLYALKSVELIAKYLPVCVK
NGSDLTARTYVALANTLSGFVESTSSCTSEHSMEHALSAFHPELPHGAGLIMLSEAYHTF
FASKIPERYINLARAMGVDVDSLPEEERPFAFVKALKKLQEECGVANLKMSDYGIKEDEI
EKLAKNAMETMGGLFEMDRYKLSFEEVVEIMRKAYK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaatttaaatttctcctattttattcctactaagatatggtttggtccagga
agcttagaaaaattaagagaagaaaagctccctggtaggaaagcacttatagttatttct
gctgggggttccatgaaaagacttggttatcttgataggcttacagatattctaaaaagt
aaaggtgtagaatatgtagtttttgataaaattcttcccaatcctattaagaagcatgta
atggaaggtgctcaaattgcaagagaagagaaatgtgattttgtaattggacttggagga
ggaagtagtattgattcagcaaagagtattgcgttgatggcaaagaatgatggtgactat
tgggattatattgtaggtggtactggaaaaggtaaaaagccagaaaaaggagctttacct
attgtggctataaccactacagcaggtacaggaactgaggcagatccatggacagtaata
accaatgaggaaactaatgagaaaatcgggtatggtaatgaatatacttttcctactttg
tccattgtagatcctgaacttatgttgagtgttccccctcatcttactgcctatcaagga
tttgatgcctttttccatgcagtagagggctatattgcaaatattgcaactccagtgagt
gatctttatgctttaaagagtgtagaattgattgctaaatatttacctgtttgtgtaaaa
aatggtagcgatcttactgcaagaacttatgtggctcttgctaataccctttcaggattt
gtagaaagtacatcaagctgtacttcggagcattctatggagcatgctctttctgctttt
catccagagcttccccatggggcaggattgattatgctttcagaggcttatcataccttc
tttgcctcaaagattcctgaaaggtatataaaccttgcaagggcaatgggtgttgatgtg
gattctcttcctgaagaggagagaccttttgcttttgttaaagcactgaaaaagcttcaa
gaagagtgtggagtggcaaatttgaagatgtctgactatggtataaaggaagatgaaatt
gagaaattggctaagaatgctatggagactatgggcggactctttgaaatggataggtat
aagttaagttttgaagaagttgtagagataatgcgaaaagcttataagtaa

DBGET integrated database retrieval system