KEGG   Dictyoglomus thermophilum: DICTH_0117Help
Entry
DICTH_0117        CDS       T00774                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
dth  Dictyoglomus thermophilum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DICTH_0117
  Lipid metabolism
   00561 Glycerolipid metabolism
    DICTH_0117
   00600 Sphingolipid metabolism
    DICTH_0117
Enzymes [BR:dth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     DICTH_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
132056..133381
Genome map
AA seq 441 aa AA seqDB search
MKISFIGAGSVVFTRNLLKDLALFPESEGIEIALMDIDPERLEVARKIAEEINEKKNKHW
KIKGYMDLKSAIENSNYVINTVQIGGKEATYVDFDIPEKYGLKQTIGDTHGIGGIMRFLR
TAPFLKDLVRNIEEYAPSALLLNFTNPMSMNQWYINDISEIETVGLCHSIPYTIEQISSY
VGVPSKEVNYKVAGINHMAWVLTFERNGENLYPLLFKAMERKEIWERDPVRFEILRMFHY
FVTESSEHNAEYVPYFIKDEELIKKLNIPIREYIRRVEENEKVFNTFKDYYLKGNKEAYE
IVKEHYGEEEEDTSKEYAIQIIHGMETNDSRLVYSIVRNEGIIDNLPMDCMVEVPCYVDK
NGVSPLKVGYLPDQLASLNLLHINVQRLAVRGAVERDKDYIYYAALLDPLASSMLSPEKI
HMMVDELLKAHKEYLKDFFIK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaagattagttttattggagctggaagtgtggtttttacaagaaatctcttaaaggat
ttggcattatttcctgagtctgagggaatagagatagctcttatggatattgatcctgag
agattagaagtagcaagaaaaatagccgaagagataaatgaaaagaaaaataagcattgg
aagattaaaggttatatggatttaaaatctgctattgaaaactctaattatgtgataaat
actgttcagataggcgggaaagaggctacttatgtagactttgatatacctgaaaaatat
ggattaaaacagaccattggagacactcacggaattggtggtataatgagatttttaagg
acagccccatttttaaaagatcttgttaggaatatagaggaatatgctccttcagcttta
cttttgaattttacaaatcctatgtctatgaatcaatggtatatcaatgatatttctgaa
attgaaaccgtaggtttatgtcattctattccttataccattgagcagatatcaagttat
gtgggggttccttcaaaggaggtaaactacaaagtagcaggcatcaatcatatggcatgg
gttttgacttttgaaagaaatggagagaatttatatcctcttctttttaaggctatggaa
agaaaagaaatatgggagagagatcctgtaaggtttgagatattaagaatgtttcattat
tttgtaacagaatcttcagaacataatgcggaatatgttccatattttattaaagatgag
gagctaattaagaagctaaatattcctattagagaatacataagaagagtagaagagaat
gaaaaagtttttaatacttttaaagactattatttgaagggaaataaagaagcttatgag
atagtaaaagaacattatggagaagaggaagaagacacttctaaggagtatgctattcaa
attattcatggtatggaaactaatgattcaaggcttgtttatagcattgttagaaatgag
gggattatagataatttacctatggactgtatggttgaagttccatgttatgtggataag
aatggggtttctcctttaaaagtagggtatttacctgatcagttagcaagtttaaatctt
cttcatataaatgtacaaagacttgcagtaagaggtgctgtagaaagggataaggattat
atttattatgctgcacttttagatcctttagcttcctccatgttatctccagaaaaaata
catatgatggtagatgaactgttaaaagctcataaggaatatttaaaagatttctttata
aagtag

DBGET integrated database retrieval system