KEGG   Dictyoglomus thermophilum: DICTH_0134Help
Entry
DICTH_0134        CDS       T00774                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
dth  Dictyoglomus thermophilum
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dth00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dth00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(147804..150896)
Genome map
AA seq 1030 aa AA seqDB search
MIKTWENHKITNINRLPARSYFYSYPTLESASYFEKKLSLGYKLLNGKWKFLYLEAPEYS
PEGFQKKDFDDSNWQEIYVPGSWEIQGFGKPNYTDLLYIFPLNPPYVPTENPCGIYRTWF
FIPANWLDKRIIIKFHGVSSAFHLWLNGFEIGYSKGSRLTSEFDISKYVVEGPNLLTVRV
YKWSDGSYLEGQDMWKLAGIIRDVEIGVEPLDGIFDFFVKTDLSEDYKKGNIKLNLKFWN
FVEEITFEYILADEYNNIIYSDNFKVSGNELNIISPYFDIKKWSDEEPYLYNLFLILRKN
QEIIQVIPQKIGFRKIEILGNKFLLNGVPIKLKGINRHEFYPSFGYFTPMDIAEKDIKLL
KQYNINSIRTSHYPNSPYFYDLCDKYGVYVISECDIETHGFELVDKHNYLANNPEWENAF
IDRIERTVHRDKNHPSIIMWSLGNESSFGINFEKCAKKIREIDNTRMIHYEGDKEGRVTD
VFSTMYTWLEPENESKSLLEVIKNCNKPYILCEYGHAMGTGPGGLKDYQELFEAHENFQG
AFIWEFCDHGLPIQNKGYGYGGDFGDEPNDSNFCIDGILFPDRTIKPGFLELKKIFEPIK
IELLNIEKGIFVIKNLYNFISLDHLLVVYSIWNNNGIIKSGEITPSNIPPRCKKEIEVED
VIKIRNNENIKQETFIDFYVILKEDTPWAKRGHIVSYFQYRIKEEEIKEETSLINNHTKT
PISVIEKGDILEIIGEDIKITFDKVKAKLIEGEKNSKKIRLFGPFFNFWRPPIDNDKNIT
SDYINKYHLPFIKERVDKFEIKDFKDFLNIETQILYGTINSTWFYVIDYSYHIYPTGDII
IKISAKTKGDKDKAPNMLPKLGFKWYLSRDLRNVRWFGRGPHTNYIDMKESALIGCYEDY
VENLMVSYIKPQDSANRSDCKYVSLTDDYGVGIFVSTSKSFDFSAYPYEDTEIQKAKHNW
ELKKSNFITLNIDYKNNALGTNSCGQNQLLKYRCKYEDFSIELFISIFNHYEISENLKYL
ISKKLLRRDK
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgattaagacttgggaaaatcacaaaataactaacataaatagactacctgcaagatcc
tacttctactcgtacccaactctagaatctgcctcttacttcgaaaaaaaattatcctta
ggatataaattattgaatggaaaatggaaatttctttacttagaagctccagaatattcg
ccagaaggatttcaaaagaaagattttgatgactctaattggcaagaaatctacgttcct
ggaagttgggagatacaaggctttggaaaacccaattatactgatctattatatattttc
ccattaaatcccccttatgttcctacggaaaatccttgcggaatttacagaacctggttt
tttattcctgcaaattggcttgataaaagaataataatcaaatttcatggagtctcttca
gctttccacttatggttaaacggctttgaaattggatatagcaaaggttcaagattaacc
tcagaattcgatataagtaaatatgttgtagaaggcccaaatttacttacagtaagagta
tacaaatggtcagatgggagttatctggaaggccaagatatgtggaaactcgcaggaatc
ataagagatgttgagattggagtcgaacctttagatggtatatttgacttcttcgtaaaa
acggatttaagcgaagattataagaaggggaatataaaacttaacctaaaattctggaac
tttgtagaagaaattactttcgaatatattcttgcggatgaatataataatataatatat
tcagataactttaaagtatctggtaacgaactaaacattatttctccttattttgatata
aaaaaatggtctgatgaagagccatatttatacaatctttttctaattcttaggaaaaac
caagaaataatacaagtaattccacaaaaaattggatttagaaaaatagaaatattagga
aataagtttttactaaatggtgttccaatcaaattgaagggaattaatagacatgagttt
tatcctagttttggatattttacccccatggacattgcagaaaaagatataaaacttcta
aaacagtacaatataaattccattagaacatcacattatccaaattctccttacttctat
gatctatgtgataaatatggtgtatacgtgatttctgaatgtgatattgaaactcatggt
ttcgaacttgttgacaagcataactaccttgctaacaaccctgaatgggaaaatgccttt
attgatcgtattgaaagaacagttcatagagataagaatcatccttctataataatgtgg
tccttaggtaatgaatcttcttttggaataaattttgaaaaatgtgcaaaaaaaatacga
gaaattgacaatactcgaatgattcactatgagggtgacaaagaaggcagagtcacagat
gtattttctactatgtatacatggcttgaacctgagaatgaaagtaaatctctactagaa
gttattaagaactgcaataaaccatatattctgtgtgagtacggacatgcaatgggcaca
ggacctggtggattaaaggattatcaagaattatttgaagcacatgaaaactttcaggga
gcctttatatgggagttttgtgatcatggattacctatccaaaataaaggttatggatat
ggaggggattttggagatgaacctaatgatagtaacttctgtatagatggaatacttttt
cctgatagaactattaaaccaggctttttagagttaaaaaaaatctttgaaccaataaaa
attgaattgcttaatattgaaaaaggcatctttgtaattaagaacttatataattttatt
tctttagatcacttgttagttgtttattcgatttggaacaataatggcataattaaaagt
ggagaaattacaccatctaacattcctccaaggtgtaaaaaagaaatagaagtagaagat
gtcataaaaatcagaaataatgaaaacataaaacaggaaactttcattgatttttatgtt
attctaaaggaagatacaccttgggctaaaagagggcatattgtttcatactttcaatat
agaattaaagaagaagaaattaaagaagaaacctctctcataaataaccatactaaaact
cccatatctgtcattgaaaagggagatattcttgaaataataggggaagacataaaaata
acatttgataaagtaaaagcaaaactaatagaaggagaaaaaaacagcaaaaaaatcaga
ctcttcggtcctttctttaatttctggagaccacctattgacaatgacaaaaatatcaca
agtgactatataaataaatatcatttaccttttataaaagagagagttgataaatttgag
ataaaagactttaaagattttttaaacatagagactcaaatcttatatggaacaataaac
tctacttggttctatgtgatagattattcatatcatatatatcctacaggagacattatt
ataaaaatatccgcgaaaactaaaggagataaagacaaagcccccaatatgctccctaaa
cttggtttcaaatggtatctttctagagatctaagaaacgtaagatggtttggaagagga
ccgcacacaaattacatagacatgaaagaatcagcacttataggatgttatgaggattat
gtcgaaaatctcatggtaagttatataaaacctcaagattcagctaatagaagcgattgt
aagtatgtgagtcttacagatgattatggggttggaatttttgttagtactagtaaatct
tttgatttcagcgcatatccttatgaagatactgaaattcagaaagcaaagcataattgg
gagttaaagaaaagcaatttcataactctaaacatagactacaagaataatgcattagga
actaactcctgcggacaaaaccaactattaaaatatcgttgtaaatacgaagatttttca
atagaactttttatttcaatatttaaccattatgaaatttccgaaaacctgaaatatctt
atttcaaagaaattacttaggagggacaaataa

DBGET integrated database retrieval system