KEGG   Dictyoglomus thermophilum: DICTH_0188Help
Entry
DICTH_0188        CDS       T00774                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DICTH_0188
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_0188
  Lipid metabolism
   00071 Fatty acid degradation
    DICTH_0188
  Amino acid metabolism
   00350 Tyrosine metabolism
    DICTH_0188
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DICTH_0188
   00626 Naphthalene degradation
    DICTH_0188
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DICTH_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
205329..206357
Genome map
AA seq 342 aa AA seqDB search
MKAMLLREVKDLTVWQDPLSLEEVSIPIPKEKEILIKVSACGVCRTDLDIVEGRLPPTKL
PLILGHQIVGTVVDKGKDANKFQIGDRVGVAWINHSCGVCRFCRSGQENLCDDFKATGKD
VDGGYAEYTVVSEDYAYKIPQNYSDEEAAPLLCAGAIGYRSVKLSNIKNGDNIGLSGFGA
SGHLVLKIIKYLYPDSKIFVFARSERERELAKELGSYWTGDFGEVTPFKLNAIIDTTPVW
KTIVLVLRNLEKGGRLVINAIRKENQDKDFLINLNYERDLWMEKEIKSVANITRRDVEEF
LTLAEKVDLKPVVEVYKLEEANKALRDLKEGRIRGAKVLKMS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaatgctccttagagaagtgaaagatcttactgtatggcaagatcctctttct
cttgaagaggtttctatccctattccaaaggagaaagagattttgataaaggtttctgct
tgtggagtttgtaggactgaccttgatattgtagaggggagacttcctcctactaaatta
cctttgattttgggacaccaaattgtgggcacggttgtggataaggggaaagatgctaat
aaattccaaattggagatagggttggagttgcatggataaatcattcttgtggggtgtgt
aggttttgtagatctggtcaggaaaatttatgtgatgatttcaaagctacgggaaaagat
gtggatggaggatatgcagagtatacggttgtctcggaggattatgcttataaaattcct
caaaattattctgatgaagaagcagcaccacttttatgtgccggtgcaataggatatagg
tcggttaagctttctaatataaaaaatggggataatattggactttctggatttggagcc
tcaggccatttagtgttgaagataataaagtatctttatccagattctaagatatttgtt
tttgcaagaagtgaaagagaaagagagttggcaaaggaattgggaagttactggacagga
gattttggtgaagttactccctttaaactaaatgctattattgacactactcctgtatgg
aaaactatagtcttagtacttaggaacttggaaaagggaggaagattggttataaatgcc
ataagaaaggaaaatcaagacaaagactttctcattaacttgaattatgaaagagatttg
tggatggagaaggagataaaaagtgttgctaatataacaaggagagatgtggaagaattt
ttaacattagcagaaaaggttgatttaaaaccagtggttgaagtatataagctggaagag
gctaataaggcattgagagatcttaaagagggaaggataagaggggcaaaagttttgaaa
atgagctaa

DBGET integrated database retrieval system