KEGG   Dictyoglomus thermophilum: DICTH_0188Help
Entry
DICTH_0188        CDS       T00774                                 

Definition
(RefSeq) alcohol dehydrogenase (EC:1.1.1.1)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DICTH_0188
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_0188
  Lipid metabolism
   00071 Fatty acid degradation
    DICTH_0188
  Amino acid metabolism
   00350 Tyrosine metabolism
    DICTH_0188
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DICTH_0188
   00626 Naphthalene degradation
    DICTH_0188
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DICTH_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
205329..206357
Genome map
AA seq 342 aa AA seqDB search
MKAMLLREVKDLTVWQDPLSLEEVSIPIPKEKEILIKVSACGVCRTDLDIVEGRLPPTKL
PLILGHQIVGTVVDKGKDANKFQIGDRVGVAWINHSCGVCRFCRSGQENLCDDFKATGKD
VDGGYAEYTVVSEDYAYKIPQNYSDEEAAPLLCAGAIGYRSVKLSNIKNGDNIGLSGFGA
SGHLVLKIIKYLYPDSKIFVFARSERERELAKELGSYWTGDFGEVTPFKLNAIIDTTPVW
KTIVLVLRNLEKGGRLVINAIRKENQDKDFLINLNYERDLWMEKEIKSVANITRRDVEEF
LTLAEKVDLKPVVEVYKLEEANKALRDLKEGRIRGAKVLKMS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaatgctccttagagaagtgaaagatcttactgtatggcaagatcctctttct
cttgaagaggtttctatccctattccaaaggagaaagagattttgataaaggtttctgct
tgtggagtttgtaggactgaccttgatattgtagaggggagacttcctcctactaaatta
cctttgattttgggacaccaaattgtgggcacggttgtggataaggggaaagatgctaat
aaattccaaattggagatagggttggagttgcatggataaatcattcttgtggggtgtgt
aggttttgtagatctggtcaggaaaatttatgtgatgatttcaaagctacgggaaaagat
gtggatggaggatatgcagagtatacggttgtctcggaggattatgcttataaaattcct
caaaattattctgatgaagaagcagcaccacttttatgtgccggtgcaataggatatagg
tcggttaagctttctaatataaaaaatggggataatattggactttctggatttggagcc
tcaggccatttagtgttgaagataataaagtatctttatccagattctaagatatttgtt
tttgcaagaagtgaaagagaaagagagttggcaaaggaattgggaagttactggacagga
gattttggtgaagttactccctttaaactaaatgctattattgacactactcctgtatgg
aaaactatagtcttagtacttaggaacttggaaaagggaggaagattggttataaatgcc
ataagaaaggaaaatcaagacaaagactttctcattaacttgaattatgaaagagatttg
tggatggagaaggagataaaaagtgttgctaatataacaaggagagatgtggaagaattt
ttaacattagcagaaaaggttgatttaaaaccagtggttgaagtatataagctggaagag
gctaataaggcattgagagatcttaaagagggaaggataagaggggcaaaagttttgaaa
atgagctaa

DBGET integrated database retrieval system