KEGG   Dictyoglomus thermophilum: DICTH_0275Help
Entry
DICTH_0275        CDS       T00774                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
dth  Dictyoglomus thermophilum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dth00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dth00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dth00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(279362..280651)
Genome map
AA seq 429 aa AA seqDB search
MPKIAFIGAGSVVFAKRLIMDILSYPELSDAEIALMDINKERLELIYELTKKIIEKLNSP
AKVIATLDRREALDGANYVINMIQVGGLEMFEKDVEIPRKYGIDQTVGDTIGPGGVFRGL
RTIPVLLDIARDMEELCPDALFINYSNPMAINCWALNKATKIKNVGLCHSVQGTAMQLAS
YIGVPYEEVYYWVAGINHMAWFLEFKRNGEDLYPRLWQAMENPEIYKKDAVRFEIMKYFG
YFVTESTHHMSEYVPYFRKNPERIKELIPERWDYLEICKNGWQPHYERIKKEIKGEEPII
IERSHEYASSIIYSMETNNPCRINGNVNNDNLITNLPKDCCVEVPCLVDKSGIHPCFVGD
LPPQLAALNRTNINVQELAVLGALEKDPNKIYQAIMLDPLTSAILELREVKKMVDEMLEA
EKEWIKIFE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaattgcgtttatcggcgctggaagtgtcgtatttgccaaaagacttataatg
gacatactctcataccctgaattgtcagatgctgaaatagccttgatggatataaataaa
gaaagattagagcttatctatgaacttactaaaaagataatagaaaaattaaactcacct
gcaaaagttatagccacattagaccgaagagaagctcttgatggtgccaattatgtgata
aacatgatacaagttggtggcttagaaatgtttgaaaaagatgtggaaataccaaggaaa
tatggaatagatcagacagtaggtgataccattgggccaggaggagtttttagagggcta
agaaccatacctgtacttcttgatattgcaagagacatggaagaattatgtccagatgct
ctttttataaactacagcaatccaatggctattaactgctgggctctaaacaaggcaact
aaaataaaaaatgtagggctctgccatagcgttcaaggaactgctatgcagcttgcaagt
tacataggagtaccctatgaggaagtttactactgggtggctggaataaaccatatggct
tggtttttagagtttaaaagaaatggtgaagatctctatccaagactttggcaagcaatg
gaaaaccctgaaatatataaaaaagatgcagtaagatttgaaattatgaaatattttgga
tactttgtcaccgaatcaacccaccacatgtccgagtatgttccatactttagaaagaat
cctgaaaggataaaagaacttatacctgagagatgggattatttagagatttgcaaaaac
ggatggcaaccccactatgaaaggataaaaaaggaaattaaaggagaggaacctataatc
attgaaagatcccatgaatatgcatcatctattatatattccatggaaacaaacaacccc
tgtagaataaatggcaacgtaaataacgataatctcattacaaacttgcccaaagactgc
tgtgtcgaagtcccttgcttggtggacaaatcaggaattcatccatgctttgtaggagac
ttaccacctcaactggcagccttgaatagaacaaacattaacgtacaggaattagcagtt
ttaggggcattagagaaagatcccaataaaatttatcaagcaattatgttagacccatta
acatctgcaatcttagagctaagagaagttaaaaagatggtagatgaaatgcttgaggca
gagaaagaatggataaaaatatttgagtaa

DBGET integrated database retrieval system