KEGG   Dictyoglomus thermophilum: DICTH_0303Help
Entry
DICTH_0303        CDS       T00774                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00010  Glycolysis / Gluconeogenesis
dth00020  Citrate cycle (TCA cycle)
dth00620  Pyruvate metabolism
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01120  Microbial metabolism in diverse environments
dth01130  Biosynthesis of antibiotics
dth01200  Carbon metabolism
Module
dth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_0303
   00020 Citrate cycle (TCA cycle)
    DICTH_0303
   00620 Pyruvate metabolism
    DICTH_0303
Enzymes [BR:dth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DICTH_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-ProteinID: ACI19091
UniProt: B5YC78
Position
309391..310095
Genome map
AA seq 234 aa AA seqDB search
MNENNVSKRIPLNTVRRTIAERLSKSKQSIPHFYAVAEVDATNLVEARANFVNEKNIKIS
YDDFIIKATALSMKEFPLINARFRETEIELLEHINIGFAVALGEEGVVVPVIRDADKKAI
TQIFEERISLVEKARNRKLRVEDISDRSITVNNVGVFGVRSILAIINPPEVAIVTCGAIQ
DRVVVVNGEVRIRKMMDITLSADHRVIDGAYGSKFLMKIKEFLESPDLLVSREE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgagaacaatgtaagcaagagaattcctttaaatactgtaagaagaactattgcc
gaaagattatcaaaaagcaagcaatcaattcctcatttttatgctgtagctgaagttgat
gctacaaatttagttgaagcaagagctaattttgtcaatgagaaaaatataaagatttct
tatgatgatttcataattaaagctacagccctttctatgaaagaatttccattgataaat
gctcgttttagagaaacagaaatagagcttttagaacacataaatattggttttgccgta
gccttaggagaagagggtgtagtagtacctgttataagagatgctgataaaaaggctata
actcaaatatttgaagaaaggatttctcttgtagaaaaagcaagaaatagaaaattaaga
gtagaagatatctctgatagaagtattaccgtgaataatgtaggcgtatttggagtgaga
tcaatacttgctataattaatcctccagaagtagctattgttacatgtggggctattcag
gatagagtggtggtagttaatggggaagtaagaatcagaaagatgatggatataactctc
tcagcagatcatagggtaatagatggagcatatggatctaagtttcttatgaaaataaag
gaatttttagaaagtcctgatttattagtaagcagggaggaataa

DBGET integrated database retrieval system