KEGG   Dictyoglomus thermophilum: DICTH_0307Help
Entry
DICTH_0307        CDS       T00774                                 

Definition
fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dth  Dictyoglomus thermophilum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DICTH_0307
Enzymes [BR:dth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     DICTH_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313143..313811
Genome map
AA seq 222 aa AA seqDB search
MNSEVEKIKRELVEIGKRIAQENLIVGPGGNISAKIEDKVYIKASGVSFEDATEDDYIGV
DLNSGRVIEGDKRPSSEIWMHLECYKVREDVRAVVHTHPIYSIAYAFQDEPLKLFTPDMV
ALLGGEIPVVEYVVPGGKEFARVVGEVIKNHNGVLVKNHGLVTVGSNLKEALYRTLLIEN
SIKTIFIAKLFGNMRFFTKEQIEEIDNLEVEKYRRKLLKEKG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgaggtagaaaaaataaaaagggagcttgtagagataggaaaaagaatagcg
caagaaaatttaattgtgggacctggaggaaatattagtgcaaaaatcgaagataaagta
tatataaaggcaagtggtgtttcttttgaggatgctactgaagatgattatattggtgtt
gatttgaattcaggtagagtaattgaaggtgataaaaggccatcttccgaaatatggatg
catcttgagtgttataaagtaagagaagatgttagggcagtggtgcatactcatcctata
tattcaattgcttatgcttttcaagatgaacctttaaaattatttacacctgacatggta
gctcttcttggaggagagattcctgtggtggaatatgtggtgcctggtggtaaagaattt
gcaagggtagttggagaggttataaaaaatcataatggtgttcttgttaaaaatcatgga
ttagtaactgtaggaagtaatcttaaagaggcgctttacaggactcttctaattgaaaat
tctataaagaccatattcatagcaaaattatttggtaatatgcgcttctttacaaaagag
cagattgaagaaattgataacttagaggtggaaaaatatagaagaaaactattaaaagaa
aagggttaa

DBGET integrated database retrieval system