KEGG   Dictyoglomus thermophilum: DICTH_0398Help
Entry
DICTH_0398        CDS       T00774                                 

Definition
alkaline phosphatase III (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dth00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dth00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dth02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
392460..394073
Genome map
AA seq 537 aa AA seqDB search
MRFDRVFSKVLLIFILVLGFVFFSSSFGVALQSSSSLYKGKPVKYIFWFIGDGMGLNHVY
LTEAFLGRKSNSPSIEKLSFTQFPNVGLMTTYAADSYITDSASAITAMAAGKKTNDGVIN
MDPTLKFKYKSVAEEARDLGYKVGVLTSVSIDHATPAGMYAHQPSRNNYYAIALELFESN
FDYFGGGGFLQPQGKDGKQKDVYEIAKEKGYKIVDKIEDFLKLRKGDNKIVAINPILDSS
KALPYAINRLRGANLGLSLADFTKKAIELLDNPKGFFIMVEGGKIDWAAHANDAGSVIYD
VLDFNEAIKVALEFYKKRPFETVIIVTADHETGGLSIGYAGTRYEVYLDVLSRQKISYDE
FTKVVNEYKSKVKREEAKLSDLLPQIKEYYGLEILSPEVRKELENRAKAGDKEAKIRLQL
ALNESEIEELEKAFKLSMMDPKERPNDAKSYLLYGGYDPLTITVTRILNQKAGISWTSYS
HTGMPVPVYAIGAGSYIFNGYYDNTDLYKKLMSLIGKDPYKDNVLSSAEVRELVFSK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtttgacagggtgttttcaaaagttctcctaatatttattttggtgttaggtttt
gtattcttttcctcttcttttggggtagctcttcagtcttcctcttccctctataaagga
aagcctgtaaagtatatcttttggtttattggggatggaatgggattaaatcatgtatat
ctgacagaagcgtttcttggcaggaaatccaatagtccatctatagagaagttaagtttt
actcagtttcctaatgtgggtttgatgacaacttatgctgctgatagttatattactgat
tctgcatctgctattactgctatggcagcaggtaagaagactaatgatggagtaattaat
atggatccaactcttaagtttaaatataagagtgttgctgaggaggcaagggatttagga
tataaagtaggggttttaaccagtgtatctattgaccatgcaactcctgctggcatgtat
gctcatcaaccaagtagaaataattactatgctatagctcttgaactttttgaaagtaat
tttgactattttgggggaggcggattcttacagcctcagggtaaggatggaaaacaaaag
gatgtatatgagattgcaaaagaaaaaggatataagattgtggataagattgaggatttt
ttgaagttgagaaaaggagataataaaatagtcgctatcaatcctatacttgattcttca
aaggcactaccttatgctataaaccgcttaagaggagcaaatttgggactctctcttgca
gattttactaaaaaggctatagagcttttagacaatcctaagggcttctttataatggta
gagggtggaaaaattgactgggctgctcatgctaacgatgcaggttcagttatatatgat
gttttagatttcaatgaagcaataaaagtggcgttagagttctataagaagagacccttt
gagacagttatcattgttacagcagatcatgaaacaggaggcttgagtataggttatgca
ggaacaagatatgaggtataccttgatgtactttcacgtcaaaaaatatcctacgatgag
tttacaaaggttgttaacgagtataagagcaaagtaaaaagagaagaggctaaactttct
gatcttttgcctcaaattaaagaatactatggtcttgagatattaagccctgaggtaagg
aaggaacttgaaaatagggcaaaagctggagataaagaggcaaaaataagattacaactt
gcattgaatgaaagtgaaattgaagagcttgaaaaagcctttaaactttccatgatggat
ccaaaagaaagacctaacgatgctaagagttatctattatatggtggctatgatccttta
actattactgtgactcgtattctaaatcaaaaggcaggaatatcttggacatcatattct
cacactggtatgcctgtacctgtttatgctattggtgctggatcttatatcttcaatgga
tattatgacaacactgatctttataaaaagctaatgagtttgataggaaaagatccttat
aaggacaatgtattatcttcagctgaagttagagagttggtgtttagtaagtaa

DBGET integrated database retrieval system